KEGG   Pan troglodytes (chimpanzee): 472084
Entry
472084            CDS       T01005                                 

Gene name
SIM1
Definition
(RefSeq) single-minded homolog 1
  KO
K09100  single-minded
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    472084 (SIM1)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    472084 (SIM1)
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 472084
NCBI-ProteinID: NP_001074957
Ensembl: ENSPTRG00000018447
VGNC: 7909
UniProt: A2T6X9 A0A2J8PUY2
Position
6
AA seq 766 aa
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPAFSYTSSS
TPTMTDNRKGAKSRLSSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLL
DPADRPGSQHDASCAYRQFSDRSSLCYGFALDHSRLVEERHFHTQACEGGRCEAGRYFLG
TPQAGREPWWGSRAALPLTKASPESREAYENSMPHIASVHRIHGRGHWDEDSVVSSPDPG
SASESGDRYRTEQYQSSPHEPSKIETLIRATQQMIKEEENRLQLRKAPSDQLASINGAGK
KHSLCFANYQQPPPTGEICHGSALANTSPCDHIQQREGKMLSPRENDYDNSPTALSRISS
PNSDRISKSSLILAKDYLHSDISPHQTAGDHPTVSPNCFGSHRQYLDKHAYTLTGYALEH
LYDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgaaagaaaagtccaaaaatgctgcgcggactaggagggagaaggaaaacagtgaattt
tatgaactggctaaattactgcctttgccctcggctatcacctcgcagctggacaaagca
tccataatcagactcacgaccagctatctcaaaatgagagtggtgttcccagaagggctc
ggcgaggcgtggggccactcaagtcggaccagccccctggacaacgttggccgagaactg
ggctcccatctgctccagaccctggatggcttcatcttcgtggtagccccagatgggaag
atcatgtacatctcagagacagcctcagtccacttgggtctttctcaggtagagctgacc
ggaaacagcatttatgaatacattcacccggcagaccacgacgagatgacggcggtgctc
accgcccatcaaccctaccactctcacttcgtgcaggagtatgagatcgagcgctccttc
ttcctgaggatgaagtgcgtcttggccaagcgtaacgccggcctcacctgtggcggctac
aaggtcatccactgcagcggctacttgaagatccgccagtacagcctggacatgtccccc
ttcgacggctgctaccaaaacgtgggcctggtggccgtgggccactcgctgcctcccagc
gccgtcacggagatcaagctacacagcaatatgtttatgttccgcgccagcctggacatg
aagctcatctttctggactccagggtggcggagctgacggggtacgaacctcaggacctg
attgagaagactctgtaccaccatgtgcacggctgcgacaccttccacctgcgctgcgcg
caccatttgctgctggtgaagggacaggtgaccaccaagtactacaggttcctggcgaaa
cacggcggctgggtatgggtgcagagctacgcgaccatcgtgcacaacagtcgctcctcc
aggccacactgtatcgtcagcgtcaactatgtcctcacagacacagaatacaaagggctg
cagctctccctggatcagatctcagcctccaaaccagccttctcctataccagcagctcc
acccccaccatgactgacaacagaaagggggccaaatcccggctctccagctcaaagtca
aaatccaggacttccccataccctcagtattcgggatttcacacagaaagatcggaatct
gatcatgacagccagtggggcggaagtcccttgacggacacggcctctccgcagcttctg
gaccccgccgataggcctggctcccagcacgacgcatcgtgcgcctacagacagttttcg
gaccgcagctctctctgctatggctttgcgcttgaccactcgaggctggtggaagagagg
catttccatacccaggcctgtgaaggaggccggtgtgaggcaggcaggtacttcctggga
acgccgcaggccgggagggagccctggtggggctctcgcgcagccttgcccctgacaaag
gcctccccagaaagcagagaagcctatgaaaacagcatgcctcacatcgcttcagtccac
aggatccatgggcgaggtcattgggatgaagatagtgtggtcagttctccagaccctggg
tcggccagtgaatcaggtgaccgatatcgtactgagcagtatcaaagtagcccacatgaa
cccagcaaaattgaaactcttataagagccactcagcaaatgattaaagaagaagagaac
agattacagctaaggaaagccccctcagaccaactggcttccattaatggggctgggaaa
aaacactccctgtgttttgcaaactaccaacagcccccaccaacaggtgaaatctgccat
ggctctgctcttgccaacacttcaccatgtgaccatatccagcagagagagggaaaaatg
ttgagcccccgtgaaaatgactatgacaacagtcccaccgcactatctcggataagtagt
cccaattcggatcgcatttcaaaatccagtttgatcctagctaaagactatctgcattcg
gatatatctcctcatcagacagcaggagaccaccctactgtctctccaaactgctttggc
tctcaccggcagtatttggacaagcatgcttacacattaactggatatgccctggagcac
ttatatgacagcgaaaccattagaaactattccttgggctgtaatggctcacactttgat
gtaacttcccatctgaggatgcaaccagacccagcacaaggacacaagggaacatctgtt
ataataaccaacggaagctga

DBGET integrated database retrieval system