KEGG   Pan troglodytes (chimpanzee): 472402Help
Entry
472402            CDS       T01005                                 

Gene name
CALN1
Definition
(RefSeq) calcium-binding protein 8 isoform X1
Organism
ptr  Pan troglodytes (chimpanzee)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF1796 EFhand_Ca_insen
Motif
Other DBs
NCBI-GeneID: 472402
NCBI-ProteinID: XP_009451613
Ensembl: ENSPTRG00000019263
UniProt: H2QUP0
Position
7
AA seq 261 aa AA seqDB search
MRLPEQPGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKGNYLN
RSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELA
IIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKH
ILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFA
MAFIISVMLIAANQILRSGME
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgccagagcaacctggagaggggaagcccgagaatgagaaaaagggggacgga
ggagcccttggagggggagaggagccgccgaggagccaggcccccgacttccccacctgg
gaaaagatgccgttccaccatgtgaccgccggcttgttgtacaaggggaattacctcaac
cgatcgctctctgctggcagtgacagcgaacagctggctaatatctccgtggaggagctc
gatgaaatccgagaggcctttcgggttctggaccgggatgggaacggcttcatctccaag
caggagctgggcatggccatgcgctctttggggtacatgccaagcgaggtggagctggct
atcatcatgcagcgcttggacatggacggggatggccaggtggattttgatgaattcatg
accattcttggccccaaactggtgtcttcagaaggtcgcgatggttttcttgggaacacg
atagacagcatattctggcagtttgacatgcaaaggataactctggaagagttgaagcac
attctctatcatgccttccgagaccacctaacgatgaaggacattgagaacatcattatc
aatgaggaagagagcctgaacgagacctcggggaactgccaaacagagtttgaaggagtg
cattcccagaagcagaacagacagacctgcgtccggaagagcctcatatgcgcctttgct
atggccttcatcatcagtgtcatgctgattgcagccaaccagatactccggagcggcatg
gagtag

DBGET integrated database retrieval system