KEGG   Pan troglodytes (chimpanzee): 473153
Entry
473153            CDS       T01005                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptr01002]
    473153 (ADAMTS13)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     473153 (ADAMTS13)
Peptidases and inhibitors [BR:ptr01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   473153 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 Peptidase_M10 Reprolysin_2 TSP1_CCN
Other DBs
NCBI-GeneID: 473153
NCBI-ProteinID: XP_016817474
VGNC: 50888
UniProt: A0A6D2X889 H2QZE3
Position
9
AA seq 1431 aa
MHQRHPRARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLKGRP
PSPGFQRQRQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLR
DPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSRTINPEDDTDPGHADLVL
YITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDG
APGSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGHP
PDAQPGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSCHTDPLDQSSCSRLLIPLLD
GTECGVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPQSPCSRSCGGGVVTRRRQCNNPRP
AFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCARTDGQPLRSSPGGASFYHWGAAVPH
SQGDALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRM
DSQQVWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLA
VRIGGRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPHLEEIRIWGPLQEDADIQ
VYRRYGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARK
ELVETVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERPVHCVEAQGSL
LKTLPPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCTSAGGAGLALENETCVPGAD
GLEAPVTEGPGSVDEKLLAPEPCVGMSCPPGWGHLDATSAGEKAPSPWGSIRMGAQAAHM
WTPAAGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWR
YKLAACSVSCGGGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEAQEACSLEPCPPRW
KVMSLGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACVALVRPQASVPCLIADCTYRW
HVGTWMECSVSCGDGIQRRRDTCLGPQVQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTP
SLVPHEEAAAPGRTTATPAGASLEWSQARALLFSPAPQPRRLLPGPQENSVQSSACGRQH
LEPTGTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRK
LLDMTFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLS
PATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYISIRDTHSLRTTAFHGQQV
LYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEVQDPQSWKGKEGT
NT seq 4296 nt   +upstreamnt  +downstreamnt
atgcaccagcgtcacccccgggcaagatgccctcccctctgtgtggccggaatccttgcc
tgtggctttctcctgggctgctggggaccctcccatttccagcagagttgtcttcaggct
ttggagccacaggccgtgtcttcttacttgagccctggtgctcccttaaaaggccgccct
ccttcccctggcttccagaggcagaggcagaggcagaggcagaggcagaggcgggctgca
ggcggcatcctacacctggagctgctggtggccgtgggccccgatgtcttccaggctcac
caggaggacacagagcgctacgtgctcaccaacctcaacatcggggcagaactgcttcgg
gacccgtccctgggggctcagtttcgggtgcacctggtgaagatggtcattctgacagag
cctgagggtgctccaaatatcacagccaacctcacctcgtccctgctgagcgtctgtggg
tggagccggaccatcaaccctgaggacgacacggatcctggccatgctgacctggtcctc
tatatcactaggtttgacctggagttgcctgatggtaaccggcaggtgcggggcgtcacc
cagctgggcggtgcctgctccccaacctggagctgcctcattaccgaggacactggcttc
gacctgggagtcaccatcgcccatgagattgggcacagcttcggcctggagcacgacggc
gcgcccggcagcggctgcggccccagcggacacgtgatggcttcggacggcgccgcgccc
cgcgccggcctcgcctggtccccctgcagccgccggcagctgctgagcctgctcagcgca
ggacgggcgcgctgcgtgtgggacccgccgcggcctcaacccgggtccgcggggcacccg
ccggatgcgcagcctggcctctactacagcgccaacgagcagtgccgcgtggccttcggc
cccaaggctgtcgcctgcaccttcgccagggagcacctggatatgtgccaggccctctcc
tgccacacagacccgctggaccaaagcagctgcagccgcctcctcattcctctcctggat
gggacagaatgtggcgtggagaagtggtgctccaagggtcgctgccgctccctggtggag
ctgacccccatagcagcagtgcatgggcgctggtctagctggggtccccaaagtccttgc
tcccgctcctgtggaggaggtgtggtcaccaggaggcggcagtgcaacaaccccagacct
gcctttggggggcgtgcatgtgttggtgctgacctccaggccgagatgtgcaacactcag
gcctgcgagaagacccagctggagttcatgtcggaacagtgtgccaggaccgacggccag
ccgctgcgctcctcccctggcggtgcctccttctaccactggggtgctgctgtaccacac
agccaaggggatgctctgtgcagacacatgtgccgggccattggcgagagcttcatcatg
aagcgtggagacagcttcctcgatgggacccggtgtatgccaagtggcccccgggaggac
gggaccctgagcctgtgtgtgtcgggcagctgcaggacatttggctgtgacggcaggatg
gactcccagcaggtatgggacaggtgccaggtgtgtggtggggacaacagcacgtgcagc
ccacggaagggctctttcacagctggcagagcgagagaatatgtcacatttctgacagtt
acccccaacctgaccagtgtctacattgccaaccacaggcctctcttcacacacttggcg
gtgaggatcggagggcgctatgtcgtggctgggaagatgagcatctcccctaacaccacc
tacccctccctcctggaggatggtcgtgtcgagtatagagtggccctcaccgaggaccgg
ctgccccacctggaggagatccgcatctggggacccctgcaggaagatgctgacatccag
gtttacaggcggtatggcgaggagtatggcaacctcacccgcccagacatcaccttcacc
tacttccagcctaagccacggcaggcctgggtgtgggccgctgtgcgtgggccctgctcg
gtgagctgtggggcagggctgcgctgggtaaactacagctgcctggaccaggccaggaag
gagttggtggagactgtccagtgccaagggagccagcagccaccagcgtggccagaggcc
tgcgtgctcgaaccctgccctccctactgggcggtgggagacttcggcccatgcagcgcc
tcctgtgggggcggcctgcgggagcggccagtgcactgcgtggaggcccagggcagcctc
ctgaagacattgcccccagcccggtgcagagcaggggcccagcagccagctgtggcgcta
gaaacctgcaacccccagccctgccctgccaggtgggaggtgtcagagcccagctcatgc
acatcagctggtggagcaggcctggccttggagaacgagacctgtgtgccaggggcagat
ggcttggaggctccagtgactgaggggcctggctccgtagatgagaagctgcttgcccct
gagccctgtgtcgggatgtcatgccctccaggctggggccatctggatgccacctctgca
ggggagaaggctccctccccatggggcagcatcaggatgggggctcaagccgcacacatg
tggacccctgcggcggggtcgtgctccgtctcctgcgggcgaggtctgatggagctgcgt
ttcctgtgcatggactctgccctcagggtgcctgtccaggaagagctgtgtggcctggca
agcaagcctgggagccggcgggaggtctgccaggctgtcccgtgccctgctcggtggcgg
tacaagctggcggcctgcagcgtgagctgtgggggaggggtcgtgcggaggatcctgtat
tgtgcccgggcccatggggaggatgatggtgaggagatcctgttggacacccagtgccag
gggctgcctcgcccggaagcccaggaggcctgcagcctggagccctgccctcctaggtgg
aaagtcatgtcccttggcccatgttcggccagctgtggccttggcactgctagacgctcg
gtggcctgtgtgcagctcgaccaaggccaggacgtggaggtggatgaggcggcctgtgtg
gcgctggtgcggccccaggccagtgtcccctgtctcattgctgactgcacctaccgctgg
catgttggcacctggatggagtgctctgtttcctgtggggatggcatccagcgccggcgt
gacacctgcctcggaccccaggtccaggcgcctgtgccggctgatttctgccagcacttg
cccaagccggtgactgtgcgtggctgctgggctgggccctgtgtgggacagggtacgccc
agcctggtgccccacgaagaagccgctgctccaggacggaccacagccacccctgctggt
gcctccctggagtggtcccaggcccgggccctgctcttctccccggctccccagcctcgg
cggctcctgcccgggccccaggaaaactcagtgcagtccagtgcctgtggcaggcagcac
cttgagccaacaggaaccattgacatgcgaggcccagggcaggcagactgtgcagtggcc
attgggcggcccctcggggaggtggtgaccctccgcgtccttgagagttctctcaactgc
agtgcgggggacatgttgctgctctggggccggctcacctggaggaaaatgtgcaggaag
ctgttggacatgactttcagctccaagaccaacacgctggtggtgaggcagcgctgcggg
cggccaggaggcggggtgctgctgcggtatgggagccagcttgctcctgaaaccttctac
agagaatgtgacatgcagctctttgggccctggggtgaaatcgtgagcccctcgctgagt
ccagccacgagtaatgcagggggctgccggctcttcattaatgtggctccgcacgcacgg
attgccatccatgccctggccaccaacatgggcgctgggaccgagggagccaatgccagc
tacatctcgatccgggacacccacagcttgaggaccacagcgttccatgggcagcaggtg
ctctactgggagtcagagagcagccaggctgagatggagttcagcgagggcttcctgaag
gctcaggccagcctgcggggccagtactggaccctccaatcatgggtaccggaggtgcag
gaccctcagtcctggaagggaaaggaaggaacctga

DBGET integrated database retrieval system