KEGG   Pan troglodytes (chimpanzee): 735881Help
Entry
735881            CDS       T01005                                 

Gene name
CYP1A2
Definition
(RefSeq) cytochrome P450 1A2
  KO
K07409  cytochrome P450 family 1 subfamily A polypeptide 2 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00140  Steroid hormone biosynthesis
ptr00232  Caffeine metabolism
ptr00380  Tryptophan metabolism
ptr00591  Linoleic acid metabolism
ptr00830  Retinol metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr01100  Metabolic pathways
ptr05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    735881 (CYP1A2)
   00591 Linoleic acid metabolism
    735881 (CYP1A2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    735881 (CYP1A2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    735881 (CYP1A2)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    735881 (CYP1A2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    735881 (CYP1A2)
   00982 Drug metabolism - cytochrome P450
    735881 (CYP1A2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    735881 (CYP1A2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     735881 (CYP1A2)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP1 family
   735881 (CYP1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Sec8_exocyst
Motif
Other DBs
NCBI-GeneID: 735881
NCBI-ProteinID: XP_016782686
VGNC: 13404
UniProt: A0A2I3S1F1
Position
15
AA seq 517 aa AA seqDB search
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSMTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAEALISRLQELM
AGPGHFDPYNQVVMSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLRFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGG
DLIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRL
SDRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFINQWQVNHDPE
LWEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEVFLFLAILLQQL
EFSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtcccagtctgttcccttctcggccacagagcttctcctggcctctgccatc
ttctgcctggtattctgggtgctcaagggtttgaggcctcgggtccccaaaggcctgaaa
agtccaccagagccatggggctggcccttgctcgggcatgtgctgaccctggggaagaac
ccgcacctggcactgtcaaggatgagccagcgctacggggacgtgctgcagatccgcatt
ggctccacgcccgtgctggtgctgagccgcctggacaccatccggcaggccctggtgcgg
cagggcgacgatttcaagggccggcctgacctctacacctccaccctcatcactgatggc
cagagcatgaccttcagcacagactctggaccggtgtgggctgcccgccggcgcctggcc
cagaacgccctcaacaccttctccatcgcctctgacccagcttcctcatcctcctgctac
ctggaggagcatgtgagcaaggaggctgaggccctgatcagcaggttgcaggagctgatg
gcagggcctgggcacttcgacccttacaatcaggtggtgatgtcagtggccaacgtcatc
ggtgccatgtgcttcggacagcacttccctgagagtagtgatgagatgctcagcctcgtg
aagaacactcatgagttcgtggagactgcctcctccgggaaccccctggacttcttcccc
atccttcgctacctgcctaaccctgccctgcagaggttcaaggccttcaaccagaggttc
ctgcggttcctgcagaaaacagtccaggagcactatcaggactttgacaagaatagtgtc
cgggacatcacgggtgccctgttcaagcacagcaagaaggggcctagagccagcggcggc
gacctcatcccacaggagaagattgtcaaccttgtcaatgacatctttggagcaggattt
gacacagtcacaacagccatctcctggagcctcatgtaccttgtgaccaagcctgagata
cagaggaagatccagaaggagctggacactgtgattggcagggagcggcggccccggctc
tctgacagaccccagctgccctacttggaggccttcatcctggagaccttccgacactcc
tccttcttgcccttcaccatcccccacagcacaacaagggacacaacgctgaatggcttc
tacatccccaagaaatgctgtgtcttcataaaccagtggcaggtcaaccatgacccagag
ctgtgggaggacccctctgagttccggcctgagcggttcctcaccgccgatggcactgcc
attaacaagcccttgagtgagaagatgatgctgtttggcatgggcaagcgccggtgtatc
ggggaagtcctggccaagtgggaggtcttcctcttcctggccatcctgctacagcaactg
gagttcagcgtgccaccgggcgtgaaagtcgacctgacccccatctacgggctgaccatg
aagcacgcccgctgtgaacacgtccaggcgcggctgcgcttctccatcaactga

DBGET integrated database retrieval system