KEGG   Pan troglodytes (chimpanzee): 737923Help
Entry
737923            CDS       T01005                                 

Gene name
GCK
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00010  Glycolysis / Gluconeogenesis
ptr00052  Galactose metabolism
ptr00500  Starch and sucrose metabolism
ptr00520  Amino sugar and nucleotide sugar metabolism
ptr00524  Neomycin, kanamycin and gentamicin biosynthesis
ptr01100  Metabolic pathways
ptr01200  Carbon metabolism
ptr04910  Insulin signaling pathway
ptr04911  Insulin secretion
ptr04917  Prolactin signaling pathway
ptr04922  Glucagon signaling pathway
ptr04930  Type II diabetes mellitus
ptr04950  Maturity onset diabetes of the young
ptr05230  Central carbon metabolism in cancer
Module
ptr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ptr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    737923 (GCK)
   00052 Galactose metabolism
    737923 (GCK)
   00500 Starch and sucrose metabolism
    737923 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    737923 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    737923 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    737923 (GCK)
   04910 Insulin signaling pathway
    737923 (GCK)
   04922 Glucagon signaling pathway
    737923 (GCK)
   04917 Prolactin signaling pathway
    737923 (GCK)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    737923 (GCK)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    737923 (GCK)
   04950 Maturity onset diabetes of the young
    737923 (GCK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     737923 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 737923
NCBI-ProteinID: XP_016812871
Ensembl: ENSPTRG00000019140
VGNC: 7384
UniProt: H2R278
Position
7
AA seq 466 aa AA seqDB search
MAMDVTRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMG
ELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRP
STTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatgtcacaaggagccaggcccagacagccttgactctggtagagcagatc
ctggcagagttccagctgcaggaggaggacctgaagaaggtgatgagacggatgcagaag
gagatggaccgtggcctgaggctggagacccatgaagaggccagtgtgaagatgctgccc
acctacgtgcgctccaccccagaaggctcagaagtcggggacttcctctccctggacctg
ggtggcactaacttcagggtgatgctggtgaaggtgggagaaggtgaggaggggcagtgg
agcgtgaagaccaaacaccagatgtactccatccccgaggacgccatgaccggcactgct
gagatgctcttcgactacatctctgagtgcatctccgacttcctggacaagcatcagatg
aagcacaagaagctgcccctgggcttcaccttctcctttcctgtgaggcacgaagacatc
gataagggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaac
aatgtcgtggggcttctgcgagacgctatcaaacggagaggggactttgaaatggatgtg
gtggcaatggtgaatgacacggtggccacgatgatctcctgctactacgaagaccatcag
tgcgaggtcggcatgatcgtgggcacgggctgcaatgcctgctacatggaggagatgcag
aatgtggagctggtggagggggacgagggccgcatgtgcgtcaataccgagtggggcgcc
ttcggggactccggcgagctggacgagttcctgctggagtatgaccgcctggtggacgag
agctctgcaaaccccggtcagcagctgtatgagaagctcataggtggcaagtacatgggc
gagctggtgcggctcgtgctgctcaggctcgtggacgaaaacctgctcttccacggggag
gcctccgagcagctgcgcacacgcggagccttcgagacgcgcttcgtgtcgcaggtggag
agcgacacgggcgaccgcaagcagatctacaacatcctgagcacgctggggctgcgaccc
tcgaccaccgactgcgacatcgtgcgccgcgcctgcgagagcgtgtctacgcgcgctgcg
cacatgtgctcggcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgag
gacgtaatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcaccccagcttc
aaggagcggttccatgccagcgtgcgcaggctgacgcccagctgcgagatcaccttcatc
gagtcggaggagggcagtggccggggtgcggccctggtctcggcggtggcctgtaagaag
gcctgtatgctgggccagtga

DBGET integrated database retrieval system