KEGG   Pan troglodytes (chimpanzee): 738212Help
Entry
738212            CDS       T01005                                 

Gene name
CAMKMT
Definition
(RefSeq) calmodulin-lysine N-methyltransferase isoform X1
  KO
K18826  calmodulin-lysine N-methyltransferase [EC:2.1.1.60]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00310  Lysine degradation
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    738212 (CAMKMT)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.60  calmodulin-lysine N-methyltransferase
     738212 (CAMKMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_16 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 738212
NCBI-ProteinID: XP_001145471
UniProt: K7BRV5
Position
2A
AA seq 323 aa AA seqDB search
MESRVADAGTGETARAAGGGPAVGCTTRGPVVSAPLGAARWKLLRQVLKQKHLDDCLRHV
SVRRFESFNLFSVTEGKERETEEEVGAWVQYTSIFCPEYSISLRHNSGSLNVEDVLTSFD
NTGNVCIWPSEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGN
EKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEGHFDIVMCADCLFLDQYR
ASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFCIQRHENYDEHISNFHSKLK
KENPDIYEENLHYPLLLILTKHG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcgagtcgcggacgctgggaccggcgagaccgcgcgagcagcgggcgggggt
ccggcagttggctgcaccactcgggggcccgtagtctcggcgcccctgggagccgcccgg
tggaagctcctgcggcaggttctgaagcaaaaacacctggatgattgcctgcgacatgta
tctgtaagaagatttgaatcatttaatctgttttcagtaacagaaggcaaagaaagggaa
actgaagaggaggttggtgcatgggtccaatatacaagcatcttctgtcctgaatacagt
atctccttaaggcataatagtggatccttgaatgttgaagatgtccttaccagctttgac
aatacaggaaatgtttgcatctggccatctgaagaggttttggcttactactgcctcaag
cacaataatatattcagggcccttgctgtgtgtgagctagggggtggcatgacatgcttg
gctgggctcatggttgctatttctgcagatgtcaaagaagttctgttaactgatgggaat
gaaaaggccatcagaaatgtgcaagacatcatcacaaggaatcagaaggctggtgtgttt
aagacccagaaaatatcaagctgcgttttacgatgggataatgagacagatgtctctcaa
ctggaaggacattttgacattgttatgtgtgctgactgcctgtttctggaccagtacaga
gccagccttgttgatgcaataaagagattactccagcccagggggaaagcaatggtattt
gccccacgccgagggaatactttaaaccagttttgcaatctagctgaaaaagctggtttc
tgtatccaaagacatgaaaattatgatgaacacatttcaaacttccactccaagttgaaa
aaggaaaacccggacatatatgaagaaaaccttcattacccgcttctgcttattttaacc
aaacatggatag

DBGET integrated database retrieval system