KEGG   Pan troglodytes (chimpanzee): 738742Help
Entry
738742            CDS       T01005                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04020  Calcium signaling pathway
ptr04024  cAMP signaling pathway
ptr04080  Neuroactive ligand-receptor interaction
ptr04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    738742 (OXTR)
   04024 cAMP signaling pathway
    738742 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    738742 (OXTR)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    738742 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ptr04030]
    738742 (OXTR)
G protein-coupled receptors [BR:ptr04030]
 Rhodopsin family
  Peptide
   Oxytocin
    738742 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 738742
NCBI-ProteinID: XP_001144020
Ensembl: ENSPTRG00000014582
VGNC: 12118
UniProt: H2QM02
Position
3
AA seq 389 aa AA seqDB search
MEGALAANWSAEAVNASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLRGKRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgcgctcgcagccaactggagcgccgaggcagtcaacgccagcgccgcgccg
ccgggggccgagggcaaccgcaccgccggacccccgcggcgcaacgaggccctggcgcgc
gtggaggtggcggtgctgtgtctcatcctgttcctggcgctgagcgggaatgcgtgtgtg
ctgctggcgctgcgcaccacacgccagaagcactcgcgcctcttcttcttcatgaagcac
ctaagcatcgccgacctggtggtggcagtgttccaggtgctgccgcagttgctgtgggac
atcaccttccgcttctacgggcccgacctgctgtgccgcctggtcaagtacttgcaggtg
gtgggcatgttcgcctccacctacctgctgctgctcatgtccctggaccgctgcctggcg
atctgccagccgctgcgctcgctgcgccgccgcaccgaccgcctggcagtgctcgccacg
tggctcggctgcctggtggccagcgcgccgcaggtgcacatcttctctctgcgcgaggtg
gctgacggcgtcttcgactgctgggccgtcttcatccagccctggggacccaaggcctac
atcacgtggatcacgctagctgtctacatcgtgccggtcatcgtgctcgctgcctgctac
ggccttatcagcttcaagatctggcagaacttgaggctcaagaccgctgcagcggcggcg
gccgaggcgccagagggcgcggcggctggcgatggggggcgcgtggccctggcgcgtgtc
agcagcgtcaagctcatctccaaggccaagatccgcacggtcaagatgactttcatcatc
gtgctggccttcatcgtgtgctggacgcctttcttcttcgtgcagatgtggagcgtctgg
gatgccaacgcgcccaaggaagcctcggccttcatcatcgtcatgctcctggccagcctc
aacagctgctgcaacccctggatctacatgctgttcacgggccacctcttccacgaactc
gtgcagcgcttcctgtgctgctccgccagctacctgaggggcaaacgcctgggagagacg
agtgccagcaaaaagagcaactcgtcctcctttgtcctgagccatcgcagctccagccag
aggagctgctcccagccatccacggcgtga

DBGET integrated database retrieval system