KEGG   Pan troglodytes (chimpanzee): 739167Help
Entry
739167            CDS       T01005                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X6
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00561  Glycerolipid metabolism
ptr01100  Metabolic pathways
ptr04714  Thermogenesis
ptr04723  Retrograde endocannabinoid signaling
ptr04923  Regulation of lipolysis in adipocytes
Module
ptr_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    739167 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    739167 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    739167 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    739167 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptr01002]
    739167 (MGLL)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     739167 (MGLL)
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S33
   739167 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Abhydrolase_3 Lipase_3 DLH Peptidase_S9 PGAP1 Thioesterase LIDHydrolase Abhydrolase_5 Abhydrolase_2 BAAT_C DUF1350 FSH1 DUF1057 DUF2974
Motif
Other DBs
NCBI-GeneID: 739167
NCBI-ProteinID: XP_001140395
Ensembl: ENSPTRG00000015348
VGNC: 2047
UniProt: H2RBJ9
Position
3
AA seq 283 aa AA seqDB search
METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD
YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVDIYNSDPLI
CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKT
LKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctgaagacccttccagcatgccagaggaaagttcccccaggcggacc
ccgcagagcattccctaccaggacctccctcacctggtcaatgcagacggacagtacctc
ttctgcaggtactggaaacccacaggcacgcccaaggccctcatctttgtgtcccatgga
gccggagagcacagtggccgctatgaagagctggctcggatgctgatggggctggacctg
ctggtgttcgcccacgaccatgttggccacggacagagcgaaggggagaggatggtagtg
tctgacttccacgttttcgtcagggatgtgttgcagcatgtggattccatgcagaaagac
taccctgggcttcctgtcttccttctgggccactccatgggaggcgccatcgccatcctc
acggccgcagagaggccgggccacttcgccggcatggtactcatttcgcctctggttctt
gccaatcctgaatctgcaacaactttcaaggtcgacatttataactcagaccccctgatc
tgccgggcagggctgaaggtgtgcttcggcatccaactgctgaatgccgtctcacgggtg
gagcgcgccctccccaagctgactgtgcccttcctgctgctccagggctctgccgatcgc
ctgtgtgacagcaaaggggcctacctgctcatggagttagccaagagccaggacaagact
ctcaagatttatgaaggtgcctaccatgttctccacaaggagcttcctgaagtcaccaac
tccgtcttccatgaaataaacatgtgggtctctcaaaggacagccacggcaggaactgcg
tccccaccctga

DBGET integrated database retrieval system