KEGG   Pan troglodytes (chimpanzee): 739640
Entry
739640            CDS       T01005                                 
Symbol
PNLIP
Name
(RefSeq) pancreatic triacylglycerol lipase isoform X1
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00561  Glycerolipid metabolism
ptr01100  Metabolic pathways
ptr04972  Pancreatic secretion
ptr04975  Fat digestion and absorption
ptr04977  Vitamin digestion and absorption
Module
ptr_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    739640 (PNLIP)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    739640 (PNLIP)
   04975 Fat digestion and absorption
    739640 (PNLIP)
   04977 Vitamin digestion and absorption
    739640 (PNLIP)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     739640 (PNLIP)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Hydrolase_4 Abhydrolase_1
Other DBs
NCBI-GeneID: 739640
NCBI-ProteinID: XP_001151144
Ensembl: ENSPTRG00000002970
VGNC: 7855
UniProt: H2Q2M3 A0A6D2YC24
Position
8:128669695..128692180
AA seq 465 aa
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVVADSSTISGSNFKTNRKTRFIIHGFIDKGEENWLADVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQKVKFIWY
NNVINPTLPRVGASKIIVETNVGQQFNFCSPETVREEVLLTLTPC
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgctgccactttggactctttcactgctgctgggagcagtagcaggaaaagaagtttgc
tacgaaagactcggctgcttcagtgatgactccccatggtcaggaattacggaaagaccc
ctccatatattgccttggtctccaaaagatgtcaacacccgcttcctcctatatactaat
gagaacccaaacaactttcaagaagttgtcgcagattcatcaaccatcagtggctccaat
ttcaaaacaaatagaaaaactcgctttattattcatggattcatagacaagggagaagaa
aactggctggccgatgtgtgcaagaatctgttcaaggtggaaagtgtgaactgtatctgt
gtggactggaaaggtggctcccgaactggatacacacaagcctcgcagaacatcaggatc
gtgggagcagaagtggcatattttgttgaatttcttcagtcggcgttcggttactcacct
tccaacgtgcacgtcattggccacagcctgggtgcccacgctgctggggaggctggaagg
agaaccaatgggaccattggacgcatcacagggttggacccagcagaaccttgctttcag
ggcacacctgaattagtccgattggaccccagcgatgccaaatttgtggatgtaattcac
acggatggtgcccccatagtccccaatttggggtttggaatgagccaagttgtgggccac
ctagatttctttccaaatggaggagtggaaatgcctggatgtaaaaagaacattctctct
cagattgtggacatagacggaatctgggaagggactcgagactttgcggcctgtaatcac
ttaagaagctacaaatattacactgatagcattgtcaaccccgatggctttgctggattc
ccctgtgcctcttacaacgtcttcactgcaaacaagtgcttcccttgtccaagtggaggc
tgcccacagatgggtcactatgctgatagatatcctgggaaaacaaatgatgtgggccag
aaattttatctagacactggtgatgccagtaattttgcacgctggaggtataaggtatct
gtcacactgtctggaaaaaaggttacaggacacatactagtttctttgtttggaaataaa
ggaaactctaagcagtatgaaattttcaagggcactctcaaaccagatagtactcattcc
aatgaatttgactcagatgtggatgttggggacttgcagaaggttaaatttatttggtat
aacaatgtgatcaacccaactttacctagagtgggagcatccaagattatagtggagaca
aatgttggacaacagttcaacttctgtagtccagaaaccgtcagggaggaagttctgctc
accctcacaccgtgttag

DBGET integrated database retrieval system