KEGG   Pan troglodytes (chimpanzee): 741145Help
Entry
741145            CDS       T01005                                 

Gene name
HSF4
Definition
(RefSeq) heat shock factor protein 4 isoform X3
  KO
K09417  heat shock transcription factor 4
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    741145 (HSF4)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Helix-turn-helix
   Heat shock factors
    741145 (HSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSF_DNA-bind AP_endonuc_2_N
Motif
Other DBs
NCBI-GeneID: 741145
NCBI-ProteinID: XP_001161177
Ensembl: ENSPTRG00000034007
VGNC: 5801
UniProt: A0A2J8Q4V9
Position
16
AA seq 462 aa AA seqDB search
MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLP
QYFKHSNMASFVRQLNMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGREQLLERVRRK
VPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQ
QHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSCPTPAKFNTCPLPGALLQDPYF
IQSPSTYSLSQRQLWALALTGPGAPSSLTSQKTLHPLRGPGFLPPVMAGAPPPLPVAVVQ
AILEGKGSFSPEGPRNAQQPEPGDPREIPDRGPLSLESGDRSPESLLPPMLLQPPQESVE
PIGPLDVLGPSLQGREWTLMDLDMELSLMQPLVPERGEPELAVKGLNSPSPGKDPTLGAP
LLLDVQAALGGPALGLPGALTIYSTPESRTASYLGPEASPSP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaagcgccagctgcgctgcccacggagccaggccccagccccgtgcctgccttc
ctcggcaagctatgggcgctggtgggggacccaggcacagaccacctgatccgctggagc
ccgagcgggaccagtttcctcgtaagcgaccagagccgtttcgccaaggaagtgctgccc
cagtatttcaagcatagcaacatggcgagcttcgtgcgccaactcaacatgtacggtttt
cggaaggtggtgagcatcgagcagggcggcctgcttaggccggagcgcgaccacgtcgag
ttccagcacccgagcttcgtgcgcggccgcgagcagctactggagcgcgtgcggcgcaag
gtgcccgcgctgcgcggcgacgacggccgctggcgcccggaggacctgggtcgactactg
ggcgaggtgcaggctttgcggggagtgcaggagagcaccgaggcgcggctgcgggagctc
aggcagcagaacgagatcttgtggcgggaggtggtgacacttcggcagagccacggtcag
cagcaccgggtcattggcaagctgatccagtgtctctttgggccacttcaggcggggccg
agcaatgcaggaggcaagagaaagctgtccctgatgctggatgaggggagctcatgccca
acacctgccaagttcaacacctgccctctacctggtgcccttctgcaggacccttacttc
atccagtcgccttctacttacagcctctcccagagacaactttgggccttagccctcaca
gggccaggggccccatcatctctgacatcccagaagactctccatcccctgaggggacca
ggctttctccctccagtgatggcaggagcccccccgccactgcctgtggctgtggtgcag
gccatcctggaagggaaagggagcttcagccccgaggggcccaggaatgcccaacagcct
gaaccaggggatcccagggagatacctgacagggggcctctgagcctggaaagtggggac
aggagcccagagagtctgctgcctccgatgctacttcagccccctcaagaaagtgtggaa
cctatagggcctctagatgtgctgggccccagtctccaagggcgagaatggaccctgatg
gacttggacatggagctgtccttgatgcagcccttggttccagagcggggtgagcctgag
ctggcggtcaaggggttaaattctccaagcccagggaaggaccccacgctcggggcccca
ctcctgctggatgtccaggcggccttgggaggcccagccctgggcctgcctggggcttta
accatttatagcactcctgagagccggaccgcctcctacttgggcccggaagccagtccc
tccccctaa

DBGET integrated database retrieval system