KEGG   Pan troglodytes (chimpanzee): 741431Help
Entry
741431            CDS       T01005                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase 2 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00010  Glycolysis / Gluconeogenesis
ptr00052  Galactose metabolism
ptr00500  Starch and sucrose metabolism
ptr01100  Metabolic pathways
ptr04068  FoxO signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04910  Insulin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04922  Glucagon signaling pathway
ptr04931  Insulin resistance
ptr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    741431 (G6PC2)
   00052 Galactose metabolism
    741431 (G6PC2)
   00500 Starch and sucrose metabolism
    741431 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    741431 (G6PC2)
   04151 PI3K-Akt signaling pathway
    741431 (G6PC2)
   04152 AMPK signaling pathway
    741431 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    741431 (G6PC2)
   04922 Glucagon signaling pathway
    741431 (G6PC2)
   04920 Adipocytokine signaling pathway
    741431 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    741431 (G6PC2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    741431 (G6PC2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     741431 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 741431
NCBI-ProteinID: XP_001155854
Ensembl: ENSPTRG00000012608
VGNC: 10811
UniProt: H2QIX7
Position
2B
AA seq 355 aa AA seqDB search
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLWFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFALGFYLLLRVLNIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS
LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYCVHMLMKQSGKKSQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcacaggaatggagtgctcataattcagcatttgcagaaggactaccga
gcttactacacttttctaaattttatgtccaatgttggagacccccggaatatctttttc
atttattttccactttggtttcaatttaatcagacagttggaaccaagatgatatgggta
gcagtcattggggattggttaaatcttatatttaaatggatattatttggtcatcgacct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccctactacatgtgaaacaggtccaggaagtccatctggccatgcaatgggctcatcc
tgtgtctggtatgtcatggtaacggctgccctgagccacactgtctgtgggatggataag
ttctctatcactctgcacagactgacctggtcatttctttggagtgttttttggttgatt
caaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcatgctggtggcagaggcctttgaacacactccaggcatccaa
acggccagtctgggcacatacctgaagaccaacctctttctcttcctgtttgcacttggc
ttttacctgcttcttagagtgctcaacattgacctgctgtggtccgtgcccatagccaaa
aagtggtgtgccaaccccgactggatccacattgacaccacgccttttgctggactcgtg
agaaaccttggggtcctctttggcttgggctttgcaatcaactcagagatgttcctcctg
agctgccgagggggaaataactacacactgagcttccggttgctctgtgccttgacctca
ttgacaatactgcagctctaccatttcctccagatcccgactcacgaagagcatttattt
tatgtgctgtctttttgtaaaagtgcatccattcccctaactgtggttgctttcattccc
tactgtgttcatatgttaatgaaacaaagcggaaagaagagtcagtag

DBGET integrated database retrieval system