KEGG   Pan troglodytes (chimpanzee): 742204Help
Entry
742204            CDS       T01005                                 

Gene name
HNMT
Definition
(RefSeq) histamine N-methyltransferase isoform X1
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00340  Histidine metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    742204 (HNMT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    742204 (HNMT)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     742204 (HNMT)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   742204 (HNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_16 EF-hand_8 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 742204
NCBI-ProteinID: XP_001156140
Ensembl: ENSPTRG00000012503
VGNC: 10833
UniProt: H2QIS2
Position
2B
AA seq 292 aa AA seqDB search
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIARIGDTKSEIKILSIG
GGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETS
SEYQSKMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWD
KLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLL
WDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVVEA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccatgaggagcttgttttctgaccacgggaaatatgttgaatctttccgg
aggtttctcaaccattccacggaacaccagtgcatgcaggaattcatggacaagaagctg
ccaggcataatagcaaggattggagacacaaaatcagaaattaagattctaagcataggc
ggaggtgcaggtgaaattgatcttcaaattctctccaaagttcaggctcaatacccagga
gtttgtatcaacaatgaagttgttgagccaagtgctgaacaaattgccaaatacaaagag
cttgtagccaagacatcgaacctcgagaacgtaaagtttgcttggcataaggagacatca
tctgaatatcaaagtaaaatgttggagaaaaaggagcttcaaaagtgggactttattcat
atgattcaaatgctgtattatgtaaaagacatcccagctaccctgaaattcttccatagt
ctcttaggtaccaatgctaagatgctcattattgttgtgtcaggaagcagtggctgggac
aagctgtggaaaaagtacggatcacgctttccccaggatgacctctgccagtatatcaca
tcagatgacctcactcagatgctggacaacctagggcttaagtatgagtgctatgacctt
ttgtccaccatggatatatctgactgctttattgatggtaatgaaaatggagacctgctt
tgggattttttgactgaaacctgcaactttaatgccacagcaccacctgatctcagagca
gagcttgggaaagatctacaagagcctgaatttagtgctaagaaagaggggaaggttctt
tttaataatactctgagtttcatagtggttgaggcataa

DBGET integrated database retrieval system