KEGG   Pan troglodytes (chimpanzee): 742383Help
Entry
742383            CDS       T01005                                 

Gene name
GATC
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00970  Aminoacyl-tRNA biosynthesis
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    742383 (GATC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptr03029]
    742383 (GATC)
Enzymes [BR:ptr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     742383 (GATC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     742383 (GATC)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    742383 (GATC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 742383
NCBI-ProteinID: XP_001160510
Ensembl: ENSPTRG00000005534
UniProt: H2Q711
Position
12
AA seq 135 aa AA seqDB search
MWSRLVWLGLRAPLGGQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVTRLEKAI
AFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGN
ISLPKLDEQEPFPHS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgcggttggtgtggctgggccttcgggcccctctgggcggccagggcttcacc
tccaaggcggatcctcagggcagtggccggatcacggctgcggtgatcgagcacctggag
cgtctagcgcttgtggacttcggcagccgcgaggcagtgacgcgactggagaaagctatc
gccttcgccgaccggctacgcgccgtggacacagacggggtggagcccatggagtcggtc
ctggaggacagatgtctatacctgagatccgacaatgtggtagaaggcaactgtgctgat
gaattactacaaaactcccatcgcgtcgtggaggagtattttgtggcccccccaggtaat
atctctttgccaaagctggatgaacaagagccattcccacacagctga

DBGET integrated database retrieval system