KEGG   Pan troglodytes (chimpanzee): 742456Help
Entry
742456            CDS       T01005                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01524  Platinum drug resistance
ptr04115  p53 signaling pathway
ptr04210  Apoptosis
ptr04215  Apoptosis - multiple species
ptr04932  Non-alcoholic fatty liver disease (NAFLD)
ptr05010  Alzheimer's disease
ptr05012  Parkinson's disease
ptr05014  Amyotrophic lateral sclerosis (ALS)
ptr05016  Huntington's disease
ptr05134  Legionellosis
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex infection
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05222  Small cell lung cancer
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    742456
   04215 Apoptosis - multiple species
    742456
   04115 p53 signaling pathway
    742456
 Human Diseases
  Cancers
   05200 Pathways in cancer
    742456
   05210 Colorectal cancer
    742456
   05222 Small cell lung cancer
    742456
  Neurodegenerative diseases
   05010 Alzheimer's disease
    742456
   05012 Parkinson's disease
    742456
   05014 Amyotrophic lateral sclerosis (ALS)
    742456
   05016 Huntington's disease
    742456
  Cardiovascular diseases
   05416 Viral myocarditis
    742456
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    742456
  Infectious diseases
   05134 Legionellosis
    742456
   05152 Tuberculosis
    742456
   05164 Influenza A
    742456
   05161 Hepatitis B
    742456
   05168 Herpes simplex infection
    742456
   05163 Human cytomegalovirus infection
    742456
   05167 Kaposi's sarcoma-associated herpesvirus infection
    742456
   05145 Toxoplasmosis
    742456
  Drug resistance
   01524 Platinum drug resistance
    742456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Motif
Other DBs
NCBI-GeneID: 742456
NCBI-ProteinID: XP_009439330
UniProt: A0A2I3TW28
Position
X
AA seq 105 aa AA seqDB search
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGYSYTVANKNKGITW
GEDTLMEYLENPKKHIPETKMIFVGIKKKEERADLIAFLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggccgctggatactcttacacggttgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaaaaagcacatccctgaaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttttctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system