KEGG   Pan troglodytes (chimpanzee): 742678
Entry
742678            CDS       T01005                                 

Gene name
COX6A2
Definition
(RefSeq) cytochrome c oxidase subunit 6A2, mitochondrial
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00190  Oxidative phosphorylation
ptr01100  Metabolic pathways
ptr04260  Cardiac muscle contraction
ptr04714  Thermogenesis
ptr04932  Non-alcoholic fatty liver disease
ptr05010  Alzheimer disease
ptr05012  Parkinson disease
ptr05014  Amyotrophic lateral sclerosis
ptr05016  Huntington disease
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
Module
ptr_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    742678 (COX6A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    742678 (COX6A2)
  09159 Environmental adaptation
   04714 Thermogenesis
    742678 (COX6A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    742678 (COX6A2)
   05012 Parkinson disease
    742678 (COX6A2)
   05014 Amyotrophic lateral sclerosis
    742678 (COX6A2)
   05016 Huntington disease
    742678 (COX6A2)
   05020 Prion disease
    742678 (COX6A2)
   05022 Pathways of neurodegeneration - multiple diseases
    742678 (COX6A2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    742678 (COX6A2)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 742678
NCBI-ProteinID: XP_001158801
Ensembl: ENSPTRG00000008046
VGNC: 8973
UniProt: H2QB05 A0A6D2XHN9
Position
16
AA seq 97 aa
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFR
PYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
NT seq 294 nt   +upstreamnt  +downstreamnt
atggctttgcctctgaggcccctgacccggggcttggccagcgctgccaaaggaggccac
ggaggagcaggagctcgcacctggcgtctgctgaccttcgtgctggcgctgcccagcgtg
gccctctgcaccttcaactcctatctccactcgggccaccgcccgcgccccgagttccgt
ccctaccaacacctccgcatccgcaccaagccctacccctggggggacggcaaccacact
ctgttccacaatagccacgtgaaccctctgcccacgggctacgaacacccctga

DBGET integrated database retrieval system