KEGG   Pan troglodytes (chimpanzee): 744025
Entry
744025            CDS       T01005                                 

Gene name
OTX1
Definition
(RefSeq) homeobox protein OTX1
  KO
K09326  homeobox protein OTX1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    744025 (OTX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    744025 (OTX1)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    744025 (OTX1)
SSDB
Motif
Pfam: TF_Otx Homeodomain SatD
Other DBs
NCBI-GeneID: 744025
NCBI-ProteinID: XP_016804107
Ensembl: ENSPTRG00000011972
VGNC: 50339
UniProt: A0A6D2X7X8 A0A2J8N3Q6
Position
2A
AA seq 354 aa
MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKT
RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSG
SESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPA
SISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSS
SYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHH
HQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgatgtcttacctcaaacaacccccatacggcatgaacgggctgggcctggccgggccc
gccatggacctcctgcacccatccgtgggctatccggccactccgcggaagcagcggcgg
gagcgcaccaccttcacgcgttcacagctggacgtgctcgaggcgctcttcgccaagact
cgctaccctgacatcttcatgcgggaggaggtggcgctcaagatcaacctgccggagtct
agagtccaggtctggttcaagaaccgccgcgccaaatgccgccagcagcagcagagcggg
agcggaaccaagagccgcccagccaagaagaagtcctctccagtgcgggagagctcgggc
tccgaaagcagtggccaattcacgccgccagctgtgtccagctctgcctcgtcctctagc
tcggcgtccagctcttccgccaacccagcggctgcagcggctgcgggactaggtgggaac
ccggtggcggccgcgtcgtcgctgagtacaccagctgcctcatctatctggagcccggcc
tccatctcgccaggctcagcgcccgcgtccgtgtcggtgccggagccattggccgcgcct
agcaacacctcgtgtatgcagcgctccgtagctgcaggcgccgccaccgcagcagcctct
tatcccatgtcctacggccagggcggcagctacggccaaggctaccctacgccctcctct
tcctactttggcggcgtggactgcagctcatacctagcgcccatgcactcacatcaccac
ccgcaccagctcagccccatggcaccctcctccatggcgggccaccatcatcaccaccca
catgcgcaccacccgttgagccagtcctcaggccaccaccaccaccatcaccaccaccac
caccaaggctacggtggctctgggcttgccttcaactctgccgactgcttggattacaag
gagcctggcgccgctgctgcttcctccgcctggaaactcaacttcaactcccccgactgt
ctggactataaggaccaagcctcatggcggttccaggtcttgtga

DBGET integrated database retrieval system