KEGG   Pan troglodytes (chimpanzee): 744540
Entry
744540            CDS       T01005                                 

Gene name
PAX2
Definition
(RefSeq) paired box protein Pax-2 isoform X6
  KO
K15608  paired box protein 2
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    744540 (PAX2)
   04131 Membrane trafficking [BR:ptr04131]
    744540 (PAX2)
   03036 Chromosome and associated proteins [BR:ptr03036]
    744540 (PAX2)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    744540 (PAX2)
Membrane trafficking [BR:ptr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    744540 (PAX2)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    744540 (PAX2)
SSDB
Motif
Pfam: PAX Pax2_C HTH_32 HTH_23 Homeodomain HTH_28 HTH_Tnp_IS1
Other DBs
NCBI-GeneID: 744540
NCBI-ProteinID: XP_001168808
Ensembl: ENSPTRG00000002853
VGNC: 5588
Position
10
AA seq 425 aa
MEERAGPAVLKLSLRGDTAAAAALLPLLCLPMDMHCKADPFSAMHPGHGGVNQLGGVFVN
GRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPK
VATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRTKVQQPFHP
TPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSE
GSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYS
LPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGS
YPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAA
AYDRH
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggaagagcgcgcgggtccggcagtcctgaagttgagtttgagaggcgacacggcggcg
gcggccgcgctgctcccgctcctctgcctccccatggatatgcactgcaaagcagacccc
ttctccgcgatgcacccagggcacgggggtgtgaaccagctcgggggggtgtttgtgaac
ggccgtcccctacccgacgtggtgaggcagcgcatcgtggagctggcccaccagggtgtg
cggccctgtgacatctcccggcagctgcgggtcagccacggctgtgtcagcaaaatcctg
ggcaggtactacgagaccggcagcatcaagccgggtgtgatcggtggctccaagcccaaa
gtggcgacgcccaaagtggtggacaagattgctgaatacaaacgacagaacccgactatg
ttcgcctgggagattcgagaccggctcctggccgagggcatctgtgacaatgacacagtg
cccagcgtctcttccatcaacagaatcatccggaccaaagttcagcagcctttccaccca
acgccggatggggctgggacaggagtgaccgcccctggccacaccattgttcccagcacg
gcctcccctcctgtttccagcgcctccaatgacccagtgggatcctactccatcaatggg
atcctggggattcctcgctccaatggtgagaagaggaaacgtgatgaagatgtgtccgag
ggctcagtccccaatggagattcccagagtggtgtggacagtttgcggaagcacttgcga
gctgacaccttcacccagcagcagctggaagctttggatcgagtctttgagcgtccttcc
taccctgacgtcttccaggcatcagagcacatcaaatcagaacaggggaacgagtactcc
ctcccagccctgacccctgggcttgatgaagtcaagtcgagtctatctgcatccaccaac
cctgagctgggcagcaacgtgtcaggcacacagacataccccgttgtgactggtcgtgac
atggcgagcaccactctgcctggttacccccctcacgtgccccccactggccagggaagc
taccccacctccaccctggcaggaatggtgcctgggagcgagttctccggcaacccgtac
agccacccccagtacacggcctacaacgaggcttggagattcagcaaccccgccttacta
agttccccttattattatagtgccgccccccggggctccgcccctgccgctgctgccgct
gcctatgaccgccactag

DBGET integrated database retrieval system