KEGG   Pan troglodytes (chimpanzee): 744997Help
Entry
744997            CDS       T01005                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X4
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptr01002]
    744997 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    744997 (ABHD12)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     744997 (ABHD12)
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   744997 (ABHD12)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   744997 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Say1_Mug180 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 744997
NCBI-ProteinID: XP_003316903
Ensembl: ENSPTRG00000013340
VGNC: 6027
UniProt: H2QK43
Position
20
AA seq 398 aa AA seqDB search
MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKR
ALGRRKGVWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQ
FVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcgccttggagcatgagcgctgcgccgccgcgggctcg
tcctcctccggctcggccgccgcggcgctggacgccgactgccgcctgaagcagaaccta
cgcctgacgggcccggcggcggctgagccgcgctgcgcagccgacgcgggaatgaagcgg
gcgctgggcaggcgaaagggcgtgtggttgcgcctgaggaagatacttttctgtgttttg
gggttgtacattgccattccatttctcatcaaactatgtcctggaatacaggccaaactg
attttcttgaatttcgtaagagttccctatttcattgatttgaaaaaaccacaggatcaa
ggtttgaatcacacgtgtaactactacctgcagccagaggaagacgtgaccattggagtc
tggcacaccgtccctgcagtctggtggaagaacgcccaaggcaaagaccagatgtggtat
gaggatgccttggcttccagccaccctatcattctgtacctgcatgggaacgcaggtacc
agaggaggcgaccaccgcgtggagctttacaaggtgctgagttcccttggttaccatgtg
gtcacctttgactacagaggttggggtgactcagtgggaacgccatctgagcggggcatg
acctatgacgcactccacgtttttgactggatcaaagcaagaagtggtgacaaccccgtg
tacatctggggccactctctgggcactggcgtggcgacaaatctggtgcggcgcctctgt
gagcgagagacgcctccagatgcccttatattggaatctccattcactaatatccgtgaa
gaagctaagagccatccattttcagtgatatatcgatacttccctgggtttgactggttc
ttccttgatcctattacaagtagtggaattaaatttgcaaatgatgaaaacgtgaagcac
atctcctgtcccctgctcatcctgcacgctgaggacgacccggtggtgcccttccagctt
ggcagaaagctctatagcatcgccgcaccagctcgaagcttccgagacttcaaagttcag
tttgtgccctttcattcagaccttggctacaggcacaaatacatttacaagagccctgag
ctgccacggatactgagggaattcctggggaagtcggagcctgagcaccagcactga

DBGET integrated database retrieval system