KEGG   Pan troglodytes (chimpanzee): 745942Help
Entry
745942            CDS       T01005                                 

Gene name
CDKN2D
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    745942 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    745942 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 745942
NCBI-ProteinID: XP_016790488
Ensembl: ENSPTRG00000010477
VGNC: 8728
UniProt: A0A2J8LWA9
Position
19
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggttcgcgccggcgaccggctgagtggggcggcggcccggggcgac
gtgcaggaggtgcgccgccttctgcatcgcgagctggtgcatcccgacgcccttaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctggagctg
ctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtccatgac
gcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggctgatgtc
aacgtgcctgatggcaccggggcacttccaatccatctggcagttcaagagggtcacact
gctgtggtcagctttctggcagctgaatctgatctccatcgcagggacgccaggggtctc
acacccttggagctggcactgcagagaggggctcaggacctcgtggacatcctgcagggc
cacatggtggccccgctgtga

DBGET integrated database retrieval system