KEGG   Pan troglodytes (chimpanzee): 748477Help
Entry
748477            CDS       T01005                                 

Gene name
PFN1
Definition
(RefSeq) profilin-1
  KO
K05759  profilin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04015  Rap1 signaling pathway
ptr04810  Regulation of actin cytoskeleton
ptr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    748477 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    748477 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    748477 (PFN1)
Membrane trafficking [BR:ptr04131]
 Others
  Actin-binding proteins
   Others
    748477 (PFN1)
Cytoskeleton proteins [BR:ptr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     748477 (PFN1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Proteins found in most exosomes
   748477 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 748477
NCBI-ProteinID: XP_009429954
Ensembl: ENSPTRG00000008616
VGNC: 9511
UniProt: H2QBZ3
Position
17
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgttcccagtac
tga

DBGET integrated database retrieval system