KEGG   Pan troglodytes (chimpanzee): 748505Help
Entry
748505            CDS       T01005                                 

Gene name
HIST1H2BB
Definition
(RefSeq) histone H2B type 1-B
  KO
K11252  histone H2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr05034  Alcoholism
ptr05203  Viral carcinogenesis
ptr05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    748505 (HIST1H2BB)
  Immune diseases
   05322 Systemic lupus erythematosus
    748505 (HIST1H2BB)
  Substance dependence
   05034 Alcoholism
    748505 (HIST1H2BB)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    748505 (HIST1H2BB)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   748505 (HIST1H2BB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 748505
NCBI-ProteinID: XP_001172713
Ensembl: ENSPTRG00000017802
VGNC: 14361
UniProt: H2QSF6
Position
6
AA seq 126 aa AA seqDB search
MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccctctaagtctgctccagcccctaaaaagggctctaagaaggctatcact
aaggcgcagaagaaggatggtaagaagcgtaagcgcagccgcaaggagagctattctatc
tatgtgtacaaggttctgaagcaggtccaccccgacaccggcatctcatccaaggccatg
gggatcatgaattccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcttctcgc
ctggctcactacaataagcgctcgaccatcacctccagggagattcagacggctgtgcgc
ctgctactgcctggggagctggctaagcatgctgtgtccgagggcactaaggcagttacc
aagtacactagctctaaataa

DBGET integrated database retrieval system