KEGG   Pan troglodytes (chimpanzee): 748534Help
Entry
748534            CDS       T01005                                 

Gene name
ADO
Definition
(RefSeq) 2-aminoethanethiol dioxygenase
  KO
K10712  cysteamine dioxygenase [EC:1.13.11.19]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00430  Taurine and hypotaurine metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    748534 (ADO)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.19  cysteamine dioxygenase
     748534 (ADO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCO_ADO CDO_I
Motif
Other DBs
NCBI-GeneID: 748534
NCBI-ProteinID: NP_001276354
VGNC: 11624
UniProt: G2HFE8
Position
10
AA seq 228 aa AA seqDB search
MQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFL
LKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPRER
EAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHY
YRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgggcttccccgagaacctgagcaagctgaagagcctcctgacccagctccgc
gccgaggacttgaacatcgccccgcgcaaggccacactgcagccgctgccgcccaacctg
ccgccagtcacctacatgcacatctacgagacggacggcttcagcctgggcgtgttcctg
ctcaagagcggcacgtccatcccgctgcacgaccacccgggcatgcacggcatgctcaag
gtgctatacggcaccgtgcgcatcagctgcatggacaagctagacgcgggcggcgggcaa
cggccgcgggccttgccgcccgagcagcagttcgagccgccgctgcagccccgggagcga
gaagccgtgcggccgggcgtgctgcgttcgcgggccgagtacaccgaggccagcggcccc
tgcatcctcacaccgcaccgggacaacctgcaccagatcgacgccgtggaagggcctgcc
gccttcctggacatcctggccccgccctacgacccggacgatggccgggactgccactat
taccgggtgctggagccggtcaggcccaaggaggcctccagctcggcctgtgacctgcct
cgagaggtgtggctcctggagaccccacaggccgatgacttctggtgcgagggagaaccc
tatccaggtcccaaggtcttcccttga

DBGET integrated database retrieval system