KEGG   Pan troglodytes (chimpanzee): 750047Help
Entry
750047            CDS       T01005                                 

Gene name
SLC9A3R2
Definition
(RefSeq) Na(+)/H(+) exchange regulatory cofactor NHE-RF2 isoform X1
  KO
K13358  Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    750047 (SLC9A3R2)
Transporters [BR:ptr02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   750047 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ EBP50_C PDZ_2 GRASP55_65
Motif
Other DBs
NCBI-GeneID: 750047
NCBI-ProteinID: XP_016784131
Ensembl: ENSPTRG00000007627
VGNC: 13773
UniProt: K7BUI0
Position
16
AA seq 337 aa AA seqDB search
MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQQGLPPAHDPWE
PKPDWAHTGSRSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVD
PGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLR
VTPTEEHVEGPLPSPFTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgccggagccgctgcggccgcgcctgtgccgcttggtgcgcggagagcagggc
tacggcttccacctgcacggcgagaagggccgccgcgggcagttcatccggcgcgtggaa
cccggttcccccgccgaggccgccgcgctgcgcgctggggaccgcctggtcgaggtcaac
ggcgtcaacgtggagggcgagacgcaccaccaggtggtgcaaaggatcaaggctgtggag
gggcagactcggctgctggtggtggaccaggagacagatgaggagctccgccggcggcag
ctgacctgtaccgaggagatggcccagcaagggctcccacccgcccacgacccctgggag
ccgaagccagactgggcacacaccggcagccgcagctccgaagctggcaagaaggatgtc
agtgggcccctgagggagctgcgccctcggctctgccacctgcgaaagggacctcagggc
tatgggttcaacctgcatagtgacaagtcccggcccggccagtacatccgctccgtggac
ccgggctcacctgccgcccgctctggcctccgcgcccaggaccggctcattgaggtgaac
gggcagaacgtggagggactgcgccatgctgaggtggtggccagcatcaaggcacgggag
gacgaggcccggctgctggttgtggaccccgagacagatgaacacttcaagcggcttcgg
gtcacacccaccgaggagcacgtggaaggtcctctgccgtcacccttcaccaatggaacc
agccctgcccagctcaatggtggctctgcgtgctcgtcccgaagtgacctgcctggttcc
gacaaggacactgaggatggcagtgcctggaagcgagatcccttccaggagagcggcctc
cacctgagccccacggcggccgaggccaaggagaaggctcgagccacgcgagtcaacaag
cgcgcgccacagatggactggaacaggaagcgtgaaatcttcagcaacttctga

DBGET integrated database retrieval system