KEGG   Paraburkholderia terricola: CUJ90_00380Help
Entry
CUJ90_00380       CDS       T05812                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pts  Paraburkholderia terricola
Pathway
pts00970  Aminoacyl-tRNA biosynthesis
pts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pts00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CUJ90_00380 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pts03029]
    CUJ90_00380 (gatB)
Enzymes [BR:pts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CUJ90_00380 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CUJ90_00380 (gatB)
Mitochondrial biogenesis [BR:pts03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CUJ90_00380 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AXE90984
Position
mHS1_A:87344..88819
Genome map
AA seq 491 aa AA seqDB search
MTKQWEVVIGLETHAQLSTQSKIFSGASTQFGAAPNTQACPVDLALPGTLPVMNRGAVER
AIQFGLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVKIQVPANEKAGKE
AYEKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAK
TLHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEV
RRQIELIEEGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDPTWVERV
KREMPELPAAIQQRFVTQYGLTPYDANMLTSSKAMAAYYEAVVAKVGPANAKVAANWLMG
EVSSQLNREGLDIAESPVSSAQLALLLQRIADGTISNKIAKEIFLAIWEEKATDEAAADR
IIEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKDKAFNALIGQAMKATKGKANPA
QVNELLKKKLS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaatgggaagtcgtgatcggtctggagacccacgcgcaactgtcgacccaa
tcgaagattttctcgggcgcctcgacgcagttcggcgccgcgcccaacacgcaggcgtgc
cccgtcgatctcgcattgccgggcaccttgcccgtgatgaaccgcggcgccgtcgagcgt
gcgatccagttcggtctcgcgatcggttcgacgatcgccccgcgcagcatcttcgcgcgc
aagaactacttctaccccgatctgcccaagggctatcagatcagccagtatgaaatcccc
gtcgtgcagggcgggcaggtgaagatccaggtgccggccaacgaaaaggcgggcaaggaa
gcgtacgagaaagtcgtcaacctcacgcgcgctcaccttgaagaagacgccggcaagtcg
ctgcacgaagacttcgcgggcatgaccggcatcgacctgaatcgcgcgggcacgccgctg
ctggaaatcgtcaccgagccggaaatgcgcagcgcggcggaagcggtcgcctacgcgaaa
acgctgcacacgctcgtcacgtggctcggaatttgcgacggcaacatgcaggaaggctcg
ttccgttgcgacgcgaacgtgtcggtgcgcccggtcggtcaggcggaattcggcacgcgc
gccgaaatcaagaacctgaactcgttccgctttctggaagaagcgatccagtacgaagtg
cgccgtcagatcgaattgatcgaggaaggcggcacggtggtgcaggaaacgcggctgtac
gatccggacaagcgcgaaacgcgttccatgcgcagcaaggaagacgcgcacgattaccgc
tatttccccgatcccgatctgatgccgctcgtgatcgatccgacgtgggtcgagcgtgtg
aagcgcgagatgccggaattgccggcagcgattcaacagcgcttcgtgacgcaatacggc
ctcacgccgtacgacgcgaacatgctcacctcgagcaaggcgatggccgcgtactacgaa
gcggtggtcgccaaggtcggcccggcgaacgccaaggtcgcggccaactggctcatgggc
gaggtgtcgtcgcaactgaatcgcgaaggcctggatattgccgaaagcccggtttcgtcc
gcgcagcttgcgctgttgttgcaacgtatcgccgacggcacgatctcgaacaagatcgcc
aaggaaattttcctcgcgatctgggaagaaaaggccaccgacgaagccgccgcggatcgc
atcatcgaggccaagggtttgaagcagatttcggacaccggcgcgctggaagcgatcatc
gacgaagtgctcgccgcgaaccagaagtcggtcgaggaattccgcgccggcaaggacaag
gcgttcaacgcgctgatcggccaggcgatgaaggcgaccaagggcaaggccaatccggcg
caggtgaatgagctgttgaagaagaagctgtcctga

DBGET integrated database retrieval system