KEGG   Paraburkholderia terricola: CUJ90_10685Help
Entry
CUJ90_10685       CDS       T05812                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pts  Paraburkholderia terricola
Pathway
pts00620  Pyruvate metabolism
pts00630  Glyoxylate and dicarboxylate metabolism
pts01100  Metabolic pathways
pts01110  Biosynthesis of secondary metabolites
pts01120  Microbial metabolism in diverse environments
pts01200  Carbon metabolism
Module
pts_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CUJ90_10685
   00630 Glyoxylate and dicarboxylate metabolism
    CUJ90_10685
Enzymes [BR:pts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CUJ90_10685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AXE92757
Position
mHS1_A:2395143..2396744
Genome map
AA seq 533 aa AA seqDB search
MANPLSSLSLPQGMEITAEIKPGYEAILTREALELVAALHRTFEPRRQQLLQARAERTKR
LDAGERPDFLAETRSVRDGDWTIAPLPQDLQCRRVEITGPVERKMIINALNSGADSYMTD
FEDSNAPSWDNQITGHINLRDAVRRTISLEQNGKSYRLNDKVATLIVRPRGWHLDEKHVK
VDGKRVSGGIFDFALFMVHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGV
PRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFRSDKDFCLADR
SRITMTAPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPAANDKAMAGVRSDKARDA
GDGYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVLVTATDLMDFRPEAPITEGG
LRNNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRKVTV
ELVRELSAEELDNVKQAVGGDTKPYERAAQIFEQMSTSEQFTDFLTLPLYEEI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatccgctgtcatcgttgtcgctgccccagggcatggaaatcacggctgaaatc
aagccgggctatgaagcgattctcacgcgcgaggcgctcgaactcgtcgccgcgctgcat
cgcacgttcgaaccgcgccgccagcagttgttgcaggcgcgcgcggagcgcacgaagcgg
ctcgacgccggcgagcgtcccgacttcctcgccgaaacccgaagcgtgcgcgacggcgac
tggaccatcgcgccgctgccgcaagacctgcaatgccggcgcgtggaaatcaccgggccg
gtggagcgcaagatgatcatcaacgcgctgaactcgggcgccgattcatacatgaccgat
ttcgaggattcaaatgcgccgagctgggacaaccagatcaccggtcacatcaatctgcgg
gatgcggtgcgccgcacgatctcgctcgaacagaacggcaagtcatacaggctgaacgac
aaggtcgccacgttgatcgtgcgtccgcgcggctggcatctggacgagaagcacgtgaag
gtggacggcaagcgcgtatcgggcggcatcttcgatttcgcgctgttcatggtgcacaac
gcgaaggaactgatcgcgcgcggctcgggcccctacttctatctgccgaagatggaaagc
catctggaagcgcgtctgtggaacgacatcttcgtcgcggcgcaggaagcggtcggcgtg
ccgcgcggcacgatccgcgcgaccgtgctgatcgaaacgatcctcgccgcgttcgaaatg
gacgagatcctgtatgaactgcgtgagcatagctcggggctgaacgccgggcgctgggac
tacatcttctcggcgatcaagaagttcagaagcgacaaggacttctgcctcgccgaccgc
tcgcggatcacgatgaccgcgccgttcatgcgcgcgtatgcgctgctgttgctgaagacc
tgccatcgccgcaatgcgccggccatcggcggcatgagcgcgctgatcccgatcaagaac
gatccggcggcgaacgacaaggccatggccggcgtgcgctccgacaaggcgcgcgatgcc
ggcgacggttacgacggcggctgggtcgcgcatccgggtctcgtgccgatcgcgatggag
gaattcgtcaaggtgctcggcgacaagcccaatcagatcggcaagcaacgcgacgacgtg
ctcgtcacggcgaccgacctgatggacttccgtcccgaagcgccgatcaccgaaggcggt
ctgcgcaacaacatcaatgtcggcattcactacctgggctcgtggctcgcgggcaatggc
tgcgtgccgattcacaatctgatggaagatgccgccaccgcggaaatctcgcgctcgcag
gtatggcaatggattcgctcgccgaagggcaagctcgacgacggccgcaaggtgacggtc
gaactggtgcgtgagctgtcggctgaggagctcgacaacgtgaagcaggcggtgggcggc
gacacgaagccctacgaacgcgccgcgcagatcttcgagcagatgtcgacgtcggaacag
ttcaccgacttcctgacgctgccgctgtacgaggaaatttga

DBGET integrated database retrieval system