KEGG   Paraburkholderia terricola: CUJ90_22545Help
Entry
CUJ90_22545       CDS       T05812                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pts  Paraburkholderia terricola
Pathway
pts00020  Citrate cycle (TCA cycle)
pts00480  Glutathione metabolism
pts01100  Metabolic pathways
pts01110  Biosynthesis of secondary metabolites
pts01120  Microbial metabolism in diverse environments
pts01130  Biosynthesis of antibiotics
pts01200  Carbon metabolism
pts01210  2-Oxocarboxylic acid metabolism
pts01230  Biosynthesis of amino acids
Module
pts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pts_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CUJ90_22545
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CUJ90_22545
Enzymes [BR:pts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CUJ90_22545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AXE95122
Position
mHS1_B:complement(894610..896838)
Genome map
AA seq 742 aa AA seqDB search
MSTPPKIIYTLTDEAPALATYSLLPIVKAFTRSSDVIVETRDISLAGRIIAAFPDYLTAE
QKGSDDLAELGGLTTRPEANIIKLPNISASVPQLKAAITELRDQGYKLPSYPDEAKTDAE
KDVKARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKMGAWSADSKSHVSHMSGG
DFYGSEKSALIAAAGSVKIELAAADGSKTVLKEKTAVQAGEIIDASVLSRNALRSFIEAE
IADAKSKGVLFSVHLKATMMKVSDPIIFGHVVSVFYKDVLTKHADALAQAGFNPNNGIGD
LYARLKDLPAETREAIEADIKAQYEQRPPLAMVNSDKGITSLHVPSDVIVDASMPAMIRE
SGKMWGADGALHDAKAVIPDRCYAGVYQAVIEDCKKNGAFDPVTMGTVPNVGLMAQAAEE
YGSHDKTFQIPANGVVRVIDAAGTVLLEQAVEAGDIWRMCQVKDAPVQDWVKLAVNRARA
TNTPAVFWLDSARAHDAQIIKKVEQYLKDHDISGLDIRIMTPVEATKFSLERIRAGKDTI
SVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMFETGAGGSAPKHVQQLVEEGFL
RWDSLGEFLALAASLEHLSNAYHNPKAQILAKTLDQATGKFLDNDKSPARKVGGLDNRGS
HFYLAMYWAEALAAQTEDAALQAQFAGVAKAMADNEAKILAELAAAQGKPVDIGGYYRPN
VELTSKAMRPSATLNKIVDAVA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaccgccgaagatcatctacaccctgaccgacgaagcccccgcgctggcgact
tactcgctgctgccgatcgtcaaggcgttcacgcgctcgtccgacgtgatcgttgaaacg
cgcgatatctcgcttgccggccggatcatcgctgcatttccggactacctgaccgcggaa
cagaagggctccgacgatctggcggaactgggcggactcaccacgcgtcccgaagcgaac
atcatcaagctgccgaacatcagcgcgtcggtgccgcaactgaaggcggcgatcaccgaa
ctgcgcgatcagggctacaagctgccgtcctatcctgacgaagcgaaaaccgacgcggaa
aaagacgtcaaggcgcgctacgacaagatcaagggcagcgccgtcaacccggtgctgcgc
gaaggcaattcggaccgccgcgcgccgttgtcggtgaagaactacgcgcgcaagcatccg
cacaagatgggcgcatggtcggctgattccaagtcgcacgtctcgcacatgagcggcggc
gatttctacggcagcgaaaagtccgcgctcatcgcggcagcgggcagcgtgaagatcgaa
ctggcggccgcggacggcagcaagacggtcctgaaagaaaagacggcggtgcaggcgggc
gagatcatcgacgcttcggtgctctccaggaatgcgctgcgcagcttcatcgaagcggaa
atcgccgatgcgaagagcaagggcgtgctgttctcggtgcacctgaaagccaccatgatg
aaggtgtcggatccgatcatcttcggtcacgtggtctcggtgttctacaaagacgtgctc
accaagcatgccgacgcgctcgcgcaagccggcttcaacccgaacaacggtatcggcgat
ctgtacgcgcgcctgaaagacctgccggccgaaacgcgcgaagcgatcgaggcggacatc
aaggcgcagtacgaacagcgcccgccgctcgccatggtcaactctgacaagggcatcacc
agcctgcacgtgccgagcgacgtgatcgtcgacgcctccatgccggccatgattcgcgag
tcgggcaagatgtggggcgcggacggcgcgctgcacgacgccaaggcggtgattccggac
cgttgctacgccggcgtctaccaggctgtgatcgaagactgcaagaagaacggcgctttt
gacccggtcacgatgggcacggtgccgaacgtcggcctgatggcgcaagccgccgaagaa
tacggttcacacgacaagacgttccagattccggcgaacggcgtggtccgcgtgatcgac
gcagccggcacggtgctgctcgaacaagcggtggaagccggcgacatctggcgcatgtgc
caggtcaaggacgcaccggtccaggattgggtcaagctcgcggtgaaccgcgcgcgcgcc
accaatacgccggccgtgttctggctcgactccgctcgcgcccatgatgcgcagatcatc
aagaaggtcgagcagtacctgaaggaccacgacatcagcggtctggacatccgcatcatg
acgccggtcgaagccacgaagttctcgctggagcgtatccgcgccggcaaagacacgatc
tcggtgaccggcaacgtgctgcgcgactacctgaccgacctgttcccgatcatggaactc
ggcaccagcgcgaagatgctgtcgatcgtcccgctcatggccggtggcggcatgttcgaa
acgggcgcaggcggttcggcgccgaagcacgttcagcaactggtcgaggaaggcttcctc
cgttgggattcgctcggcgaattcctggcgttggctgcgtcgctcgaacatttgagcaac
gcgtaccacaacccgaaggcgcagattctggcgaaaacgctggatcaggcaaccggcaag
ttcctcgacaacgacaagtcgccggcacgcaaggtgggcggtctcgacaaccgcggcagc
cacttctacctcgcgatgtactgggctgaagcgctggccgcgcaaaccgaggacgccgcg
ctgcaggcgcagttcgccggcgtggcaaaggccatggccgacaacgaagcgaagattctc
gcggagttggctgcggcgcaaggcaagccggtggatatcggcggttactaccgtccgaat
gtcgagctcacgagcaaggccatgcgcccgagcgccacgctgaacaagatcgtggatgcg
gttgcctaa

DBGET integrated database retrieval system