KEGG   Paraburkholderia terricola: CUJ90_27090Help
Entry
CUJ90_27090       CDS       T05812                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pts  Paraburkholderia terricola
Pathway
pts00260  Glycine, serine and threonine metabolism
pts01100  Metabolic pathways
pts01110  Biosynthesis of secondary metabolites
pts01120  Microbial metabolism in diverse environments
pts01130  Biosynthesis of antibiotics
pts01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CUJ90_27090
Enzymes [BR:pts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CUJ90_27090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AXE95922
UniProt: A0A1M6K3F3
Position
mHS1_B:1906254..1907261
Genome map
AA seq 335 aa AA seqDB search
MIDLRSDTVTRPTPAMLAAMSAAEVGDDVWGDDPTVLRLQASVAERAGKEAGLFFPSGTQ
SNLAALMAHCARGDEYIVGQLAHTYKYEGGGAAVLGSIQPQPLENAADGSIPLDKIAAAI
KPIDNHFARTRLLALENTIGGKVLPEGYVAEAVQLARQRGLSVHLDGARVYNAAVASGKP
VAALCEPFDSVSICFSKGLGAPVGSVLVGSHALIDVAHRWRKVLGGGMRQAGVLAAACLY
ALDHNVERLADDHANAAHLAAGLEAIEPVKVQSVATNMVFAQFPQQHCAPLEAWLKERGI
LTQMLYASRFVTHKDVSRADIDTFVAAVKGYFAAR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttgcgcagcgataccgtaacccgtccgaccccggccatgctcgcggccatg
tccgctgccgaagtgggcgacgacgtctggggcgacgaccccaccgtgctgcgcctgcag
gcaagcgtcgcggagcgcgccggcaaggaggcggggctgttcttcccgagcggcacgcaa
agcaatctggcggcgttgatggcgcactgcgcgcgcggcgacgaatacatcgtcgggcaa
ctggcgcacacctataagtacgagggcggcggcgcggcggtcctcggcagcatccagccg
cagccgctcgaaaacgccgccgacggttcgattccgctcgacaagatcgccgccgcgatc
aagccgatcgacaaccacttcgcgcgcacgcgcctgctggcgctggagaacaccatcggc
ggcaaggtgctgcccgaggggtatgtcgccgaggcggtgcaactcgcgcgtcaacgcggc
ctgtcggtccacctcgacggcgcgcgcgtctacaacgcggcggtcgcgtcgggcaagccg
gtcgcggcgctgtgcgagccgttcgattcggtctcgatctgtttctcgaagggactcggc
gcgccggtgggctcggtgctggtcggcagccacgcgctgatcgacgtggcgcaccgctgg
cgcaaggtgctgggcggcggcatgcgccaggccggcgtgctggcggcggcgtgcctgtac
gcgctggatcacaacgtcgagcgtctcgccgacgaccacgcgaacgccgcgcacctggcg
gccgggctcgaagcgatcgagccggtcaaggtgcagtcggtcgcgaccaacatggtgttc
gcgcagtttccgcagcagcattgcgcgccgctcgaagcgtggctgaaggagcgcggcatt
ctcacgcagatgctgtacgcgtcgcgattcgtcacgcacaaggatgtgtcgcgtgccgat
atcgatacgtttgtcgccgcggtgaaggggtatttcgcggcgcggtga

DBGET integrated database retrieval system