KEGG   Paraburkholderia terricola: CUJ90_27995Help
Entry
CUJ90_27995       CDS       T05812                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pts  Paraburkholderia terricola
Pathway
pts00630  Glyoxylate and dicarboxylate metabolism
pts01100  Metabolic pathways
pts01110  Biosynthesis of secondary metabolites
pts01120  Microbial metabolism in diverse environments
pts01130  Biosynthesis of antibiotics
pts01200  Carbon metabolism
Module
pts_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CUJ90_27995
Enzymes [BR:pts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CUJ90_27995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AXE96076
UniProt: A0A1M6KF03
Position
mHS1_B:2106159..2106587
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEIGLQIDYALSQGWACSVEYTDDPHPRNTYWEMWGLPMFDLRD
AAGVLQEVRACRAAWPQHYIKVNAFDSERTFETMRLSFIVNRPDDEPGFRLTRQDGAGRV
QRYGLSSYAGDRPAGERYGPAR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattacacaaggcacattttccttcttgccggaattgaccgacgaggagatcggc
ttgcagatcgactatgcgttgagccagggctgggcctgctcggtggaatacaccgacgac
ccgcatccgcgcaatacgtactgggaaatgtggggcttgcccatgttcgatctgcgcgat
gcggccggcgtgttgcaggaggtgagggcatgccgcgcggcgtggccgcagcactacatc
aaggtcaatgcgttcgattcggagcgcaccttcgagacgatgcgcctgtcgttcatcgtc
aaccggccggacgacgagccgggtttccgtctcacgcggcaggatggcgcggggcgcgtg
cagcgctatggactgtcgagctatgcgggcgaccggcccgcgggtgagcgctacggcccg
gcacggtaa

DBGET integrated database retrieval system