KEGG   Photorhabdus thracensis: VY86_00365Help
Entry
VY86_00365        CDS       T03944                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
ptt  Photorhabdus thracensis
Pathway
ptt00130  Ubiquinone and other terpenoid-quinone biosynthesis
ptt00627  Aminobenzoate degradation
ptt01100  Metabolic pathways
ptt01110  Biosynthesis of secondary metabolites
ptt01120  Microbial metabolism in diverse environments
ptt01220  Degradation of aromatic compounds
Module
ptt_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:ptt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    VY86_00365
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    VY86_00365
Enzymes [BR:ptt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     VY86_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AKH65696
UniProt: A0A0F7LUZ6
Position
complement(149334..149918)
Genome map
AA seq 194 aa AA seqDB search
MKRLIVGLTGASGAIYGVRLLQVLQPVGGIETHLVISQSARQTLALETNYSLRDVQALAD
VVYDNRDIAAAISSGSFKTSGMIVLPCSIKTLSGIVHSYTDGLVTRAADVVLKEGRKLVL
GVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPEQIQDIIDQTVNRVLDQFDIELPH
DLFTRWQGAKGVEI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattgatcgtggggcttacaggagcaagcggggctatttatggcgtcaggctg
ctgcaagttttacagccagttgggggcatagaaacacatctggtcatcagtcagtccgct
cgccagacactggcccttgaaacaaattatagtttacgagatgtgcaagcgctggctgat
gtcgtgtatgacaacagagatatagccgctgctatctcttccggttcgttcaaaacttcg
ggtatgatcgttttgccatgttcaataaaaaccctttcaggtattgttcacagctatacc
gatggattagtgaccagagcggcagatgttgtattgaaagaaggtcgtaagttggtgctt
ggtgtgagagaaacgccattgcatttggggcatctcaggttgatgactcaggcggcagaa
ataggtgcggtgattatgccgccagtgcctgcattttatcatcggcctgaacagattcag
gatattattgaccagacggttaatcgggtgctcgatcagtttgatatcgagctacctcat
gacctgtttacccgttggcaaggcgctaaaggtgttgagatttag

DBGET integrated database retrieval system