KEGG   Photorhabdus thracensis: VY86_02975Help
Entry
VY86_02975        CDS       T03944                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ptt  Photorhabdus thracensis
Pathway
ptt00650  Butanoate metabolism
ptt00900  Terpenoid backbone biosynthesis
ptt01100  Metabolic pathways
ptt01110  Biosynthesis of secondary metabolites
ptt01120  Microbial metabolism in diverse environments
ptt01130  Biosynthesis of antibiotics
ptt01200  Carbon metabolism
ptt01212  Fatty acid metabolism
ptt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ptt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VY86_02975
   00630 Glyoxylate and dicarboxylate metabolism
    VY86_02975
   00640 Propanoate metabolism
    VY86_02975
   00650 Butanoate metabolism
    VY86_02975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VY86_02975
   00072 Synthesis and degradation of ketone bodies
    VY86_02975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VY86_02975
   00310 Lysine degradation
    VY86_02975
   00380 Tryptophan metabolism
    VY86_02975
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VY86_02975
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VY86_02975
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VY86_02975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptt04147]
    VY86_02975
Enzymes [BR:ptt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VY86_02975
Exosome [BR:ptt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VY86_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKH62462
UniProt: A0A0F7LKU3
Position
730237..731415
Genome map
AA seq 392 aa AA seqDB search
MRDVVVVAAKRTATGSFRGSLADQPATFLGSTVIRALLAESGVAARDIEQVIMGQVLTAG
CGQNPARQTALRAGLPVTIQAMTINKVCGSGLKAVHLGMQAIQSGEAEIVIAGGQENMSL
APHILPMSRQGIRLGHCELKDSLVHDGLWDAFHHFHMGVTAENVAKQFNITRAQQDEYAL
LSHHRAVHAQQAGYFNDEIVAVEIAGRKGETLRFVQDEGPRETSIEKLSSLKPVFQKEGT
VTAGNASSLNDGAAAVLLCSREKAESLNLQPLATLGGFANTGIEPELMGVAPIEAIHQCI
LKQQWKPEDVDVLESNEAFAAQALAVLSSCGVPSERVNPYGGAIALGHAIGASGCRILVT
LIHNLRRNRLQNGIAALCIGGGEGVALAVTCS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgttgttgttgttgctgctaaacgtacggcaacgggtagtttccggggttcg
ctagctgatcaaccagcaacttttcttggcagtacggtcatccgtgccttgctagcagaa
agtggtgttgctgcacgagatattgaacaggtcattatggggcaagtgctgacggccggt
tgtggacaaaatccagcgcggcaaactgcattgcgagcggggttaccagttactatccaa
gctatgacaattaataaggtctgtggttcaggtctgaaagctgttcatttgggtatgcaa
gcgatccagagtggtgaagcggagatagttattgctggtgggcaggagaacatgtctctg
gctcctcacattctacccatgtctcgacaagggattcgtctcggccactgtgaactgaaa
gatagtttggtacatgatggcctttgggatgcttttcatcattttcacatgggagtaaca
gcagaaaatgttgcaaagcaatttaatataacacgtgctcagcaggatgaatatgcgctt
ctatcacatcaccgggctgttcatgctcaacaggcggggtattttaatgacgagattgtt
gctgttgagatagcaggaagaaagggagaaactctccgtttcgtacaagatgaggggcca
cgggagactagcatagaaaaattatcttctctgaagcctgtctttcagaaagaagggaca
gttaccgctggtaatgcatcttccctgaatgatggtgctgcggcagtgttattatgtagc
cgcgagaaagcagaaagtctaaatttacagccattggctactttgggcggctttgccaat
acaggtattgagcccgagctcatgggagtggctcccattgaagcgatacaccagtgtata
ttaaaacagcaatggaagcctgaggatgttgatgtacttgagtcaaacgaggcatttgct
gcgcaggctttggctgtgctttcttcgtgtggtgttccatctgagcgtgtcaatccttat
ggtggtgctattgctttaggacatgccatcggtgcttctggatgccgcattcttgtgacg
ttaatccataacttgagacggaaccgtttgcagaatggtatcgctgcgctgtgtattggc
ggtggtgaaggagtggctttggcggtcacttgttcataa

DBGET integrated database retrieval system