KEGG   Photorhabdus thracensis: VY86_18780Help
Entry
VY86_18780        CDS       T03944                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ptt  Photorhabdus thracensis
Pathway
ptt00450  Selenocompound metabolism
ptt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VY86_18780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ptt03016]
    VY86_18780
Enzymes [BR:ptt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     VY86_18780
Transfer RNA biogenesis [BR:ptt03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    VY86_18780
 Prokaryotic Type
    VY86_18780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AKH65086
UniProt: A0A0F7LTA8
Position
4298729..4299772
Genome map
AA seq 347 aa AA seqDB search
MSTEVRLTQYSHGAGCGCKISPKVLETILHSEQEKFLDPHLLVGNETRDDAAVYDIGNGT
GIISTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGKPIMAIAILGWPMDKLAPEIACKV
IEGGRAVCKDAGISLAGGHSIDAPEPIFGLAVTGIVNIDRVKRNSAAKAGSQLFLTKPLG
IGVLTTAEKKSLLLPEHQGVATATMCRLNKPGADLAEVAGVTAMTDVTGFGLLGHLSEIC
QGSGVRATIHFAKIPKLPEVESYIEKGCVPGGTGRNFDSYGHLIGEMTALQRNLLCDPQT
SGGLLLAVLPEAADEVKMIARCHGIELTAIGELSEQQSGRVLIEVNE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagaagttcgccttacccagtacagtcacggtgctgggtgcggctgcaaaatt
tcaccgaaagttttggaaaccattctgcatagtgagcaggaaaaatttcttgatcctcac
ttactggtgggtaatgaaacgcgtgatgatgcggcggtttatgatattggcaatggtacg
ggcattatcagtacgactgatttctttatgccgatcgttgatgatccgtttgattttggg
cggattgccgcgacaaatgctatcagcgatatttatgccatgggcggtaagcccattatg
gcgatagcgattctgggatggccaatggataaactggcgccggaaattgcctgcaaggtg
attgaaggtggccgggctgtttgtaaagacgcagggatttcactggcgggaggacattct
attgatgcgcctgagcctattttcggtctggctgtaaccggtatcgttaacattgaccgg
gtgaaacggaacagtgcagcgaaagccggtagccagctatttctgacaaagccgcttggc
attggggtattgaccacggcggagaaaaaaagcctgttgttgcctgagcatcagggtgtc
gcgacagcaaccatgtgtcgcctaaataaaccgggggctgatcttgccgaagttgcgggt
gttacagcaatgactgatgtgaccgggtttggtctgttagggcatttgagtgaaatttgt
caaggatcgggtgtccgggcaactatccattttgcaaaaattcctaaactgccggaagtg
gaatcttatattgaaaaagggtgtgttccggggggcaccgggcgtaattttgacagttat
ggtcatcttattggtgaaatgacagcgcttcagcgtaacctgttatgtgatccgcaaaca
tcaggcggcctgttgctggccgttctgccagaagcggcagatgaagtgaaaatgattgca
cgatgtcatggcattgaactgacagcaattggtgagttgtctgagcaacagtcaggcaga
gtgctgattgaggttaatgaataa

DBGET integrated database retrieval system