KEGG   Pseudoalteromonas tunicata: PTUN_a0182Help
Entry
PTUN_a0182        CDS       T05187                                 

Gene name
cobQ
Definition
(GenBank) adenosylcobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu00860  Porphyrin and chlorophyll metabolism
ptu01100  Metabolic pathways
Module
ptu_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PTUN_a0182 (cobQ)
Enzymes [BR:ptu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     PTUN_a0182 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA
Motif
Other DBs
NCBI-ProteinID: ATC93012
Position
I:complement(177747..179243)
Genome map
AA seq 498 aa AA seqDB search
MIYQANKMKSPNTLMVQGTTSDAGKSVLVAALCRILVRHGVQVAPFKPQNMALNSAVTAQ
GGEIGRAQAVQAEAAKIPPHVDMNPVLLKPNSDIGAQVILLGKSIGNIDAFDYHQYKPKM
LGHVLAAHQRLTEQYQAVIVEGAGSPAEINLRDRDIANMGFAEEADCPVIIVADIDKGGV
FAHLVGTYDLLSPTEQKRVKGFIINKFRGDISLLQPGIDWLEARLGIPVLATIPYIQNLH
IEAEDAIDFSQTLDQKNHIKVTVIVYPRISNHTDFDVLRLHPNVELTFARTPNEAPHSDL
IILPGSKNVQADLAWLKQQGWQSVIHQHLRYGGKVLGICGGYQMLGQSISDPHALESAQA
TQSQGLGLLAMTTELQSEKTLTNVSGICQSSKAPIKGYEIHLGVSLGEALSRPLFTLNDD
IAEGAQSDDGQIKGTYLHGILDNQALLESWLSWAGLKQITPFDYPAFRDQQLDYLADEVE
KVWPIEQIKRLLKLDSTQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgatttatcaagcgaataaaatgaaaagccccaataccctgatggtgcaaggcaccact
tcagatgcaggtaaaagcgtacttgttgctgcactttgtcgcattttagtgcgccacggc
gttcaagttgccccttttaagcctcaaaatatggcgcttaatagcgcggtgaccgcacaa
ggaggtgaaattggccgtgcacaggcagtgcaagcagaggctgcaaagattccacctcat
gttgatatgaatccggtattacttaaacccaactctgacattggcgcgcaagttatttta
cttggtaaatcaattggaaatatcgatgcctttgattaccaccaatacaaacctaaaatg
ctgggccatgttttggctgcccaccagcgcttaacagagcaatatcaagcggtgattgtt
gaaggcgcaggcagccctgccgaaatcaatctgcgcgatcgcgatattgccaatatgggt
tttgccgaagaagccgattgcccagtgattattgtggccgatatcgacaaaggcggtgta
ttcgcccacttagttggcacctatgacttgctgagccccacggaacaaaaaagagtaaaa
ggatttattatcaataagtttcgtggtgacatcagcttattacaacctggtattgattgg
cttgaggcacgtctgggtattccggtactggcaaccattccatatattcaaaatttacac
attgaagcagaagatgccattgattttagccaaacactcgaccaaaaaaatcatattaaa
gtgacggtgatcgtttaccctcgaatttcaaaccacaccgattttgacgtgctacgctta
catcccaatgtagaactcacgtttgcccgtacaccaaacgaagcaccacacagcgactta
attattttaccgggcagtaaaaatgtacaagccgatttagcgtggctaaaacaacaaggc
tggcaaagtgtcattcatcaacatttgcgctatggcggtaaagtacttggtatttgtggt
ggttatcaaatgctaggtcaaagtattagcgaccctcatgcgctcgaatcggcacaagcc
acccaatctcaagggttaggtttactggctatgaccacggagcttcagagcgagaaaacc
ctcacgaatgtcagcggtatttgccaaagttctaaagcacctattaaaggctacgaaatt
catttaggcgtttcactaggcgaggctttatcgcgcccactttttacacttaatgacgat
attgccgaaggtgcgcaaagtgatgacggccaaataaaaggcacctatttacatggtatt
ttagacaatcaggctttactcgaaagctggctctcatgggcaggccttaaacaaatcact
ccgtttgactatcccgcttttcgcgatcagcaactcgactacttagccgatgaagtcgaa
aaagtttggccaatcgaacagattaagagattgttgaaattagacagcactcaataa

DBGET integrated database retrieval system