KEGG   Pseudoalteromonas tunicata: PTUN_a1792Help
Entry
PTUN_a1792        CDS       T05187                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PTUN_a1792 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptu03400]
    PTUN_a1792 (recB)
Enzymes [BR:ptu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PTUN_a1792 (recB)
DNA repair and recombination proteins [BR:ptu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PTUN_a1792 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 PDDEXK_1 UvrD_C_2 AAA_25 AAA_30 DUF1999 V_ATPase_I_N Terminase_6
Motif
Other DBs
NCBI-ProteinID: ATC94374
Position
I:1655811..1659362
Genome map
AA seq 1183 aa AA seqDB search
MQGLNPITMPLKGVSLIEASAGTGKTYTITALYLRHLLGLQVAGQTGVPLTVEQILVVTF
TEAATAEIKDRVRKRIILARDALMGGDCDDAVVQAILSEVSETKMAFALLDAAAKSMDDA
AIFTIHGFCQRMLKQHAFESGVAFNLTFIMDQSELLTEALKDYWRTFVYGLTKERTAHVL
AYFPAPERLYKKVAALLSRSGAKIQPQINLDEVWQWQEQYLSLLARFKIDYLKSDFAAAI
LNSDLKKTKPAAKAPNLELLLAFCQSEQTVFEFGSDKKSFEIWAADNFLDPEMYKKGGKT
FSHPLCQVFTELSELQQKLTFGMPIAIAQQATKWVSAALSTKKQEQRLISPDDLLTQLHH
ALFSDGGDTLASQIAADFPVAMIDEFQDTDPIQYGIFSQIFNRESCAFTMIGDPKQAIYG
FRGADIFTYINAKHQVSTEQQYTLGKNWRSSTGIVNSVNALFNHHDNSFIFNQDIPFLAV
EAQGKTAEQALYLDGKAVTAFEFCVLEHDAPVTSKAYAMPRLAAHFSDKIATLLQQAQAG
RATIGSHAVQAADICVLVRDRNEASFIKEALSKQGIASVYLSRDGVLQSPLALHLLNFLT
ALHGQYDESAYRGVLAGPLFNLNYQQIYQLAENEQTWQQYLALFSELSDIWYKKGAMAML
ELLLMRNNLAGLWQAMGLPVERWLTDFRHLAEILQQKQLELEGSLRLVRWFAQNIIDTSK
ESAQLRLESDAKLVKIVTMHASKGLEYPLVFMPFAVGFREASEQIYHQDGELVYNLIKDD
ASQQLAEKERLAEDLRLLYVALTRPVHQCFIGMYNIAVGNSKSMTIQRTALGHLLFAGQT
LTSATDWHQLLNAFAAAHSADMAVSYFAETDSKISLSDELTVPNYERKLFTGKIERNWRL
TSFSALSYNQASEHITPGFEDESHELDWLGEEQSNELNQFSFPRGARAGSCLHAIFEEID
FQHPDTHPSDPSKNLGAVVEQQLQKYSIEPHWQLVAEQWIKRVLSTPLDADGLSLNKLGA
QQCLIEMEFYLPFERLDATGINQVLDSVASESVFKHNLKFETIQGMLKGFIDLIFEWQGK
YYVLDYKSNHLGELASDYQQSNMEEVMQSHHYHLQYLLYSVALHRLLKTRLADYDIEQHL
GGVYYLFLRGMGEGEGIYFKKIAKEIILQLDRMFEQATLEVTY
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggcttaatccaatcaccatgccgcttaagggcgtatcacttattgaagccagc
gcaggcaccggtaaaacttacacaattactgctttgtatttgcgccatttattgggttta
caagtagctggtcaaacaggtgtgccacttacggtagaacaaattttagtggtgactttt
accgaagcagcgacagctgaaatcaaagaccgcgtgcgtaaacgcattattcttgcccgt
gatgccttgatgggcggcgactgtgatgatgccgtggtacaagcaattttaagtgaagtc
agtgagactaaaatggcctttgccttgttagatgcggcggcaaaatccatggatgatgcg
gctatttttactattcatgggttttgccagcggatgctaaaacaacatgcgtttgaatcg
ggtgttgcatttaatctcacgtttattatggatcagtccgaattgctgactgaagcactt
aaagattattggcgtacgtttgtttatggcttaacaaaagagcgcactgcgcatgtactt
gcgtattttcccgcgcctgaacgtttatataaaaaagtggcggcgttgttatcacgtagt
ggcgctaagatacagccgcaaattaatcttgatgaggtctggcaatggcaagaacagtat
ttgtctttgttagcccgctttaaaatagactatttaaagtctgattttgcagcggctatc
ttaaattctgaccttaaaaaaaccaaaccagcggctaaagcgcctaatcttgagctgtta
ttggcattttgccaaagtgaacaaactgtatttgaatttggctcagataaaaaatcattt
gaaatttgggccgctgataactttttagaccctgagatgtataaaaagggcggtaaaacc
tttagccatcctttatgtcaggtgtttaccgagctcagtgagctgcaacaaaagctcact
tttggcatgcccatcgcaatcgctcaacaagcaactaagtgggtgagtgcggcattaagc
accaaaaaacaagagcagcgcctaatcagccccgatgatttattaacccaattacaccac
gccttatttagcgatgggggcgatactttggcaagtcaaattgcggcggattttccggtt
gcgatgattgacgaatttcaagataccgacccaattcaatacggtatttttagccaaata
tttaaccgagaaagctgcgcttttaccatgataggtgatccaaaacaggctatttatggc
tttcgcggcgcggatatttttacctatattaatgcaaaacatcaggtatcgaccgagcag
caatacaccttaggtaaaaattggcgctcaagcacaggcatagtcaatagcgttaatgcc
ttgtttaatcatcacgataatagctttatttttaatcaagacattccatttttagcggtt
gaagcacaaggtaaaactgcagaacaagcactgtatcttgacggtaaagcagtgactgcg
tttgagttttgtgtgcttgaacatgatgcgcctgtcaccagtaaagcttatgccatgcca
agattggccgcacattttagcgataaaatagccaccttgttgcaacaagcgcaagcaggg
cgtgccacgattggcagccatgctgttcaggcggcagatatttgtgtgctggtgcgagac
cgaaatgaagcgtcgtttattaaagaggcgttaagcaagcaggggattgccagtgtgtat
ttatcccgcgatggtgtcttacaaagcccactggctttgcatttattaaactttttaacc
gccttacatggtcaatatgatgagtcagcttatcgtggggttttagcgggccctttattt
aatttaaattatcaacaaatctaccaattggcagaaaatgaacaaacgtggcagcaatat
ttagccctttttagcgaattgagcgatatctggtacaaaaaaggcgccatggcgatgctt
gaattattgctgatgcgtaataatttggcgggtttatggcaagcaatggggctgccagtt
gaacgttggttaacggattttcgccatcttgctgaaattttgcagcaaaagcagttagaa
cttgaagggagtttacggttagtacgatggtttgcacaaaatattatcgataccagtaaa
gaaagtgcgcaacttaggcttgaaagtgacgctaaattagtaaaaattgttaccatgcat
gcatcaaaaggattggaatatcctttggtttttatgccatttgcggttggctttcgtgaa
gcatctgagcaaatttatcatcaagatggtgaacttgtttacaatcttattaaagacgat
gccagtcagcaacttgccgaaaaagagcgtttagccgaagacttacgcttattgtatgta
gccttaactcgcccagtgcatcagtgctttattggcatgtataacattgcggtgggcaat
agtaaaagcatgacaattcaacgtacagccttaggccatttgttgtttgctggccaaacc
ctcactagcgctaccgattggcatcagttattaaatgcctttgcggcagcacattcagcc
gatatggccgtgagctattttgctgagactgatagtaagatctctttgagtgatgagctc
acagtgcccaactatgagcgcaaactatttactggcaaaattgagcgtaactggcgttta
accagctttagcgcgcttagttataatcaagcatcagaacacattaccccaggttttgaa
gatgaaagccatgagctcgattggcttggcgaagagcaaagcaacgaactcaatcaattt
agttttccaagaggagcaagggcggggagttgcttacatgctatttttgaggagattgat
tttcagcatcctgatacgcacccaagcgatccgagtaaaaatcttggcgctgtggttgag
caacaacttcaaaaatattcaatcgaaccccattggcaactcgttgcagagcaatggata
aagcgcgtattaagtacgcccctcgatgctgatggcttgagtttaaataagcttggcgcc
caacaatgtttaatcgaaatggagttttatttaccttttgagcgtcttgatgccacaggt
attaatcaagtactcgatagtgtggcaagtgaaagtgtgtttaaacataacctgaaattt
gaaaccattcagggcatgttaaaaggttttatcgacttaatatttgagtggcaaggtaaa
tactatgtgcttgattataaatcgaatcatttaggtgagctggcgagcgattatcagcaa
agtaatatggaagaagtcatgcaatcgcatcattaccacttacagtatttgttatacagc
gttgcgttacatcgattattaaaaacccgcttggccgattacgatatcgagcagcattta
gggggtgtttactatttatttttgcgaggcatgggcgaaggcgaaggcatatattttaaa
aaaatagccaaagagatcattttgcaactcgaccgtatgtttgaacaagcaactttagag
gtgacctattaa

DBGET integrated database retrieval system