KEGG   Pseudoalteromonas tunicata: PTUN_a1904Help
Entry
PTUN_a1904        CDS       T05187                                 

Gene name
frmA
Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu00010  Glycolysis / Gluconeogenesis
ptu00071  Fatty acid degradation
ptu00350  Tyrosine metabolism
ptu00625  Chloroalkane and chloroalkene degradation
ptu00626  Naphthalene degradation
ptu00680  Methane metabolism
ptu01100  Metabolic pathways
ptu01110  Biosynthesis of secondary metabolites
ptu01120  Microbial metabolism in diverse environments
ptu01130  Biosynthesis of antibiotics
ptu01200  Carbon metabolism
ptu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTUN_a1904 (frmA)
  09102 Energy metabolism
   00680 Methane metabolism
    PTUN_a1904 (frmA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PTUN_a1904 (frmA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PTUN_a1904 (frmA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PTUN_a1904 (frmA)
   00626 Naphthalene degradation
    PTUN_a1904 (frmA)
Enzymes [BR:ptu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PTUN_a1904 (frmA)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     PTUN_a1904 (frmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N PALP AlaDh_PNT_C 2-Hacid_dh_C Met_10
Motif
Other DBs
NCBI-ProteinID: ATC94462
Position
I:complement(1762882..1764015)
Genome map
AA seq 377 aa AA seqDB search
MENQFIKSKAAIAWGPNQPLSIEEVDVMYPKAGEVLVKIIATGVCHTDAFTLSGQDPEGV
FPAIMGHEGAGIVHAIGEGVTSVAIGDHVIPLYTPECGECKFCTSGKTNLCQKIRATQGK
GLMPDGTTRFYKDGQPIFHYMGTSTFSEYTVLPEISLAKVNKTAPLEEICLLGCGVTTGM
GAVMNTAKVKAGDTVAIFGLGGIGLSAIIGAQMAGASQIIGVDINPSKFELAKKLGATLC
INPKDYDKPIQEVIVELTDGGVDFSFECIGNVDVMRSALECCHKGWGESVIIGVAGAGQE
ISTRPFQLVTGRVWRGSAFGGVKGRSELPHIVERYLAGEFKLDDFITHTMALEQINEAFD
LMHSGESIRSVIHFDHK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaattcataaaatcaaaggcagctatcgcatggggtccaaatcaaccttta
tctattgaagaagttgatgttatgtacccaaaagctggtgaagtattagttaaaattatc
gccactggtgtttgccataccgatgcatttaccttatcgggtcaagatcctgaaggtgtt
ttcccagcaattatgggtcatgaaggtgcaggaattgttcatgcaattggtgagggtgta
acaagtgttgctattggtgatcatgtgatcccactttacacccctgagtgtggcgaatgt
aaattctgtacttcaggaaaaacaaacttatgccaaaaaatacgagcaactcaaggcaaa
ggcttaatgcctgacggtactacgcgtttttataaagatggccaacctatttttcattat
atgggtacctctacattttctgaatacaccgttttacctgaaatctcacttgcaaaagta
aataaaaccgccccacttgaagaaatttgtttattaggctgtggtgtcacaaccggtatg
ggcgcggtaatgaataccgctaaagtaaaagcgggcgatacagtggctatttttggttta
ggaggcattggcctttctgccattattggcgcacaaatggctggtgccagccaaatcata
ggggttgatataaatccatcaaaatttgaactggcgaaaaaactaggggcgactttatgt
atcaatccaaaagactacgataaaccgatccaagaagtgattgttgaattaaccgatggc
ggagtcgatttttcatttgaatgtattggtaacgtcgatgtgatgcgctctgcacttgag
tgttgccacaaaggctggggtgaatctgtgatcatcggtgttgccggtgcaggacaagaa
atctcaacccgccctttccaacttgtaactggccgtgtatggcgcggtagtgcttttgga
ggcgtaaagggtcgctctgaattaccacacattgttgagcgctatcttgctggtgaattt
aaactggacgattttattacccacaccatggcacttgaacaaatcaatgaagcgtttgat
ttaatgcacagtggtgaaagtattcgttctgttatccattttgatcataaataa

DBGET integrated database retrieval system