KEGG   Pseudoalteromonas tunicata: PTUN_a4045Help
Entry
PTUN_a4045        CDS       T05187                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu00480  Glutathione metabolism
ptu00590  Arachidonic acid metabolism
ptu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PTUN_a4045
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PTUN_a4045
Enzymes [BR:ptu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PTUN_a4045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ATC96276
Position
I:3753282..3753764
Genome map
AA seq 160 aa AA seqDB search
MVPFYQFEAISLQGKPISFEEYQGKVVLVVNTASQCKLTPQFKALEALYQKYQSQGLVIL
GFPCNQFRQQEPGNAEDITQVCSLNYGVTFAMFDKIAVNGKHSSPIFQYLKQQLPGIFGS
IIKWNFTKFLIGRDGQPIKRYAPITNPANIEQAIINALKN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggttccgttttatcaatttgaagcaatcagtttacaaggaaaaccaatctcatttgag
gagtatcaaggtaaagttgttttagtggtcaatactgcaagccaatgcaaactgacgcca
caatttaaagcacttgaagcgctatatcagaagtatcaatctcaaggattagtgatctta
ggatttccatgtaaccaatttcgccaacaggaacctggtaatgccgaagacatcacacaa
gtgtgttcactaaattacggcgtcacctttgcaatgttcgataaaatcgcagttaatggt
aagcacagctcacccatcttccagtatttaaaacaacaattacccggaatatttggctca
atcataaagtggaattttactaagtttttgataggaagggatgggcaacccataaaacgc
tatgcaccaataacaaatccagcaaatattgaacaagcaatcataaatgctttaaaaaac
tag

DBGET integrated database retrieval system