KEGG   Pseudoalteromonas tunicata: PTUN_b0755Help
Entry
PTUN_b0755        CDS       T05187                                 

Gene name
phoD
Definition
(GenBank) alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu00790  Folate biosynthesis
ptu01100  Metabolic pathways
ptu02020  Two-component system
Module
ptu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTUN_b0755 (phoD)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PTUN_b0755 (phoD)
Enzymes [BR:ptu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PTUN_b0755 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD Metallophos
Motif
Other DBs
NCBI-ProteinID: ATC97096
Position
II:792422..793027
Genome map
AA seq 201 aa AA seqDB search
MKKVIAIIAASLLSLNGHAASQKILFGSCAHQDKPMPILGQVAKEQGDVFIFLGDNIYGD
TEDMNLMAAKYQQLANNPDFKTLKQSTPLIAVWDDHDFGQNDAGAQYPMKEQSRKLMLDF
WQEPKDSARYTQKDGIYTSYFYGDEANKVHIILPDLRFNRSPLAQVSAQDYKNKREPNKM
GPYSPTTDPKASMLGENQWQC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaatagccattattgctgccagtttactgagtttaaacggtcatgccgcc
agtcaaaaaattctatttggctcgtgtgcacatcaagataaaccaatgccaatcttgggc
caagtggccaaagagcagggcgatgtgttcattttcttaggggataatatttatggtgat
accgaagatatgaacttaatggccgcaaaatatcaacaattagccaataatccagacttt
aaaaccctcaagcaaagtaccccgcttattgctgtgtgggatgaccatgattttggtcaa
aatgatgccggcgcccaatacccgatgaaagagcaaagccgtaagctgatgctcgatttt
tggcaagagccaaaggattcagcccgttatacccaaaaagatgggatctataccagttat
ttttatggtgacgaagccaataaagtccatattattttgcctgatttacgttttaatcgc
agtccattggcacaggttagcgcgcaagattataaaaataagcgtgaaccaaataaaatg
ggtccttatagcccaacaactgatccaaaggcatcgatgttaggtgaaaatcagtggcaa
tgctag

DBGET integrated database retrieval system