KEGG   Pseudomonas trivialis: AA957_01180Help
Entry
AA957_01180       CDS       T04006                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00620  Pyruvate metabolism
ptv00630  Glyoxylate and dicarboxylate metabolism
ptv01100  Metabolic pathways
ptv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA957_01180
   00630 Glyoxylate and dicarboxylate metabolism
    AA957_01180
Enzymes [BR:ptv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AA957_01180
    1.2.1.22  lactaldehyde dehydrogenase
     AA957_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKS04784
UniProt: A0A0H5A1Y8
Position
259853..261286
Genome map
AA seq 477 aa AA seqDB search
MSSVPVYQNFINGRFTPSEAHIDVLNPATGALLSKVPASTAADVDQALAAARQAQKAWAR
KPAIERAGHLRRIAAKLRENVAHLARTITLEQGKTTGLAEVEVNFTADYLDYMAEWARRI
EGEIITSDRQNENIFLFRKPLGVVAGILPWNFPFFLIARKMAPALLTGNTIVIKPSEETP
NNCFEFAKLVAETDLPAGVFNVVCGDGQVGGALTAHKGVDMISFTGSVATGSRIMTAAAP
NITKLNLELGGKAPAIVLADADLDLAVKAIRDSRIINTGQVCNCAERVYVERKVADQFIE
RISAAMSATRYGDPIARADVEMGPLINRQGLDSVNRKVRTALSQGASLVSGGQIADLGAG
FHFEPTVLAGCRADMEIMREEIFGPVLPIQIVDDLDEAIALANDCDYGLTSSIYTRDLGK
AMHAVREIDFGETYVNRENFEAMQGFHAGVRKSGIGGADGKHGLYEYTHTHVVYLQS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgttcccgtttaccagaacttcatcaatggccgcttcacgcccagcgaagcg
cacattgacgtgctcaacccggccaccggcgcgctgctgtccaaggtgccggcgtccacc
gctgccgatgtcgaccaagccctggccgccgcgcgccaggcgcaaaaggcctgggcgcgt
aaacccgccatcgaacgcgccgggcacctgcggcgcatcgccgccaaactgcgtgagaac
gtcgcccacctggcgcgcaccatcaccctggagcaaggcaaaaccactggcttggcggag
gtggaagtgaatttcaccgccgactacctcgactacatggccgagtgggcgcggcgcatc
gaaggcgagatcatcaccagcgaccgccagaacgaaaatatcttcctgttccgcaagccg
ttgggcgtggtggccggcatcctgccgtggaattttccgttcttcctgatcgcgcgcaaa
atggcgccggcgctgctcaccggcaacaccatcgtgatcaagcccagcgaagaaaccccg
aacaactgctttgaattcgccaagctcgtcgccgagaccgacctgcccgccggcgtgttc
aacgtggtctgcggcgacggccaggtcggcggcgcactcacggcgcacaaaggcgtggac
atgatcagcttcaccggcagcgtggccaccggttcgcggatcatgaccgccgccgccccg
aacatcaccaagctcaacctggaactgggcggcaaagccccggccatcgtgctggcggac
gccgacctggacctggcggtgaaagccatccgtgactcgcgcatcatcaacaccggccaa
gtgtgcaactgcgccgagcgcgtgtacgtggagcgcaaggtcgccgatcaattcatcgag
cgcatcagcgcggccatgtccgccacccgctacggcgaccccatcgccagggccgacgtg
gaaatgggcccgctgatcaatcgccagggcctggacagcgtcaaccgcaaggtgcgcacc
gcgttgagccagggcgcaagcttggtcagtggcgggcagattgccgacctgggggcgggt
tttcacttcgagccgacggtattggccggttgccgcgccgacatggagatcatgcgcgaa
gagatcttcggcccggtactgccgatccaaattgtcgacgacctcgacgaagccatcgca
ctggcgaatgactgtgactatggcctgacctcgtcgatctacacccgcgacctgggcaag
gccatgcacgcggtgcgcgagatcgactttggcgaaacctacgtcaaccgcgagaacttc
gaggccatgcaaggcttccacgccggcgtgcgcaaatccgggattggcggtgccgacggc
aagcacggcctgtacgagtacacccacacgcacgtggtgtacctgcagagctga

DBGET integrated database retrieval system