KEGG   Pseudomonas trivialis: AA957_06115Help
Entry
AA957_06115       CDS       T04006                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00020  Citrate cycle (TCA cycle)
ptv00620  Pyruvate metabolism
ptv01100  Metabolic pathways
ptv01110  Biosynthesis of secondary metabolites
ptv01120  Microbial metabolism in diverse environments
ptv01130  Biosynthesis of antibiotics
ptv01200  Carbon metabolism
Module
ptv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AA957_06115
   00620 Pyruvate metabolism
    AA957_06115
Enzymes [BR:ptv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AA957_06115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AKS05691
UniProt: A0A0H5A476
Position
complement(1392599..1394245)
Genome map
AA seq 548 aa AA seqDB search
MFKKVNTALLGLALSMGITSVHAEEAKKVDVLLIGGGIMSATLGVWLNELEPGWSMEMVE
RLDGVAEESSNGWNNAGTGHSALAELNYTPEDKNGNVEIPKAVEINEAFQISRQFWSWQV
RQGVLKDPRSFINTTPHMSFVWGDDNIKFLKKRYEALKASPLFAGMQYSEDPAQIAKWVP
LMMEGRDPNQKIAATWSPLGTDMNFGEITRQFVAHLQTTPKFDLKLSSEVQDITKNADGS
WRVSYKNLKDGTKTETDAKFVFIGAGGGALHLLQKSGIPEAKEYAGFPVGGSFLVTDNPT
VAEQHLAKAYGKASVGAPPMSVPHLDTRVLDGKRVILFGPFATFSTKFLKEGSYLDLLTS
TTTHNIWPMTKVGIREYPLVEYLAGQLMLSDDDRFKALQEYFPNAKQSDWRLWQAGQRVQ
IIKRDEEQGGVLKLGTEVVSSADNTIAGLLGASPGASTAAPIMLTVLQKVFKDKVATPEW
QAKLHQIVPSYGTKLNDSPEAVAKEWAYTAEILQLPTPPVIPQMAAPKATEAAKPAAAPS
KPASDLAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaagtaaacactgccctgctggggctggctttgtcgatggggatcacgtcc
gttcacgcggaagaggcaaagaaagtcgatgtgctgctgatcggcggcggcatcatgagt
gcgaccctgggtgtatggctcaatgagctggagccaggctggtcgatggaaatggtcgag
cgcctcgacggcgtcgccgaagaaagctccaacggctggaacaacgccggtaccggtcac
tcggcgctggctgagctgaactacaccccggaagacaagaacggcaacgttgaaatcccg
aaagcggtcgagatcaacgaagcgttccagatctcccgtcagttctggtcgtggcaggtc
cgtcagggcgtgctgaaggacccacgttcgttcatcaacaccacgccgcacatgagcttt
gtgtggggcgatgacaacatcaagttcctcaaaaagcgctacgaggcgctgaaagccagc
ccgctgttcgccggcatgcagtactccgaagacccggcgcagatcgccaagtgggttccg
ctgatgatggaagggcgtgacccgaaccagaaaatcgcggccacctggagcccgctgggt
accgacatgaacttcggcgagatcacccgccagttcgttgcgcatctgcagaccactcct
aagttcgacctgaaactgtcgagcgaagtgcaggacattaccaagaacgccgacggttcg
tggcgtgtgagctacaaaaacctgaaagacggcaccaagactgaaaccgacgccaagttc
gtgttcatcggcgctggcggcggtgcactgcacctgctgcaaaaatccggcatcccggaa
gccaaggaatacgccggtttccctgtgggcggctcgttcctggtgaccgataacccaacg
gttgccgagcagcacttggccaaggcctacggtaaggcttcggttggcgcgccaccgatg
tcggttccgcacctggacacccgcgtgctggatggtaagcgcgtgatcctgtttggccca
ttcgcgaccttctccaccaagttcctcaaagaaggctcgtacctggacctgctgaccagc
accaccacccacaacatctggccaatgaccaaagtcggtattcgtgaatacccactggtc
gagtacctcgccggccaactgatgctgtcggatgatgaccgcttcaaggcactgcaagag
tacttcccgaacgccaagcaatccgactggcgcctgtggcaagccggtcagcgcgtgcag
atcatcaagcgtgacgaagagcagggcggcgtcctgaaactcggcaccgaagtggtcagc
tccgccgacaacaccatcgcaggcctgttgggtgcatcgccaggcgcgtccaccgcggct
ccgatcatgctgaccgtgctgcaaaaagtgttcaaggacaaggttgcgacccctgagtgg
caggccaaactgcatcagatcgtaccgagctacggcaccaagctgaacgacagtcctgag
gctgttgccaaggaatgggcctacaccgccgagatcctgcaactgcctacaccgccagtg
attccgcaaatggcggcgccaaaggcgaccgaggctgccaagcctgcggctgcgccgagc
aagccagcgtctgacctggcgctgtaa

DBGET integrated database retrieval system