KEGG   Pseudomonas trivialis: AA957_07060Help
Entry
AA957_07060       CDS       T04006                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00010  Glycolysis / Gluconeogenesis
ptv00071  Fatty acid degradation
ptv00350  Tyrosine metabolism
ptv00625  Chloroalkane and chloroalkene degradation
ptv00626  Naphthalene degradation
ptv01100  Metabolic pathways
ptv01110  Biosynthesis of secondary metabolites
ptv01120  Microbial metabolism in diverse environments
ptv01130  Biosynthesis of antibiotics
ptv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA957_07060
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AA957_07060
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AA957_07060
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AA957_07060
   00626 Naphthalene degradation
    AA957_07060
Enzymes [BR:ptv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AA957_07060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AKS05868
UniProt: A0A0H5A7C1
Position
complement(1591754..1592902)
Genome map
AA seq 382 aa AA seqDB search
MSSTFFIPAVNIMGTDCLDEAMIAIRNYGFHKALIVTDAGLAKAGVASMIAEKLAMQDID
SVIYDGAKPNPNVENVEKGLALLQQSDCDFVVSLGGGSPHDCAKGIALCATNGGHIGDYE
GVDQSSKPQLPLVAINTTAGTASEMTRFCIITDETRHVKMAIVDRNVTPLLSVNDPSLMV
GMPKGLTAATGMDALTHAIEAYVSTAATPITDACAIKAIELISANLRLAVRDGSDKAARE
NMAYAQFLAGMAFNNASLGFVHAMAHQLGGFYDLPHGVCNAVLLPHVQSFNASVSAKRLS
DVGRALGADIKGITDEEGAQAAIAAIRSLASDVEIPAGLRELGAKLQDIPLLATNALKDA
CGLTNPRRADQRQIEEIFRNAF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccttcttcattcccgccgtcaacatcatgggcaccgactgcctcgacgaa
gccatgatcgccatccgcaactacggctttcacaaggcactgatcgtcaccgacgccggc
ctggccaaggcgggcgtagcgagcatgatcgccgagaaactggcgatgcaggacatcgat
tcggtgatctacgacggcgccaagcccaaccccaacgtggaaaacgtcgagaaaggcctg
gcgctgttgcaacagagcgactgtgacttcgtggtgtccctgggcggcggctcgccccac
gactgcgccaagggcatcgccctgtgcgccaccaacggcgggcatatcggcgactacgaa
ggcgtcgaccaatcgagcaaaccgcagctgccgctggtagccatcaacaccaccgccggc
accgccagcgagatgacccgtttctgcatcatcaccgacgaaacccgccacgtgaaaatg
gccatcgtcgaccgtaacgtcacgccgctgctgtcggtcaacgacccgagcctgatggtc
ggcatgcccaagggcctcaccgctgccaccggcatggacgcgttgacccatgccatcgaa
gcctatgtgtccaccgccgccacaccgatcaccgacgcctgcgcgatcaaggccatcgaa
ctgatcagcgccaacctgcgcctggccgtccgcgacggcagcgacaaagccgcacgggaa
aacatggcctacgcgcagttcctcgccgggatggcgttcaacaacgcatcgctgggtttc
gtgcacgccatggcgcaccaattgggtggtttctacgacctgccccacggcgtgtgcaac
gcggtgctgctgccccacgtgcaaagcttcaacgccagtgtcagcgccaaacgcctgagc
gacgtgggccgcgcattgggcgccgacatcaagggcatcaccgacgaagagggcgcacaa
gccgccatcgccgccattcgtagcctggcctcggacgttgaaatcccggcgggcctgcga
gaactgggcgccaaattgcaggacattccgctgctggctaccaatgcgctgaaggatgcc
tgtggcttgaccaacccacggcgcgcggatcagcgtcagattgaggagatctttcgtaac
gcgttctga

DBGET integrated database retrieval system