KEGG   Pseudomonas trivialis: AA957_07125Help
Entry
AA957_07125       CDS       T04006                                 

Definition
(GenBank) beta-D-glucoside glucohydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00460  Cyanoamino acid metabolism
ptv00500  Starch and sucrose metabolism
ptv01100  Metabolic pathways
ptv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AA957_07125
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AA957_07125
Enzymes [BR:ptv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AA957_07125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like PHP
Motif
Other DBs
NCBI-ProteinID: AKS05881
UniProt: A0A0H5A4P8
Position
1605837..1608128
Genome map
AA seq 763 aa AA seqDB search
MKKLCLLGLVATLASHPVWAETKPAALKDKDAFVSDLLKQMTLDEKIGQLRLISIGPEMP
RELIRKEIAAGRIGGTFNSITRPENRPMQDAAMRSRLKIPMFFAYDVIHGHRTIFPISLA
LASSWDMEAIGRSGRIAAQEAAADSLDITFAPMVDISRDPRWGRTSEGFGEDTYLVSRIA
DVMVKAFQGVSPANADSIMASVKHFALYGAVEGGRDYNVVDMSPVKMYQDYLPPYHAAIK
AGSGGVMVALNSINGVPATANTWLMNDLLRRDWGFKGVAVSDHGAIFELIKHGVAKDGRE
AAKLAIKAGIDMSMNDSLYAKELPGLLKSGEIEQSDIDNAVREVLGAKYDMGLFKDPYLR
IGKAEDDPADTYAESRLHRADARDIARRSLVLLKNQNNTLPLKKSATIALVGPLAKAPID
MMGSWAAAGKPEQSVTLLDGMNAVIGEKGKIIYARGANITNDKAVVDYLNFLNFDAPEVV
DDTRPAQVMIDEAVKAAKDADVVVAAVGESRGMSHESSSRTDLNIPQSQRDLIKALKATG
KPLVLVLMNGRPLSIVEENQQADAILETWFAGTEGGNAIADVLFGDYNPSGKLPITFPRS
VGQIPTYYNHLTVGRPFTPGKPGNYTSQYFDDTTGPLFPFGYGLSYTTFNLSDMALSSTT
LNKTGKLDASVTVTNTGKVDGETVVQLYIQDVAGSMIRPIKELKNFQKVMLKAGEERTLH
FTITEEDLKFYNTQLKFAAEPGEFNVQIGLDSQDVQQQTFELL
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgtgtttgctcggccttgttgccactctggccagtcaccccgtatgggca
gaaacaaagcctgctgcgcttaaagacaaggacgcgtttgtcagcgacctgctcaagcag
atgaccctggacgaaaagatcggccaattgcgcctgatcagcatcggccccgagatgccc
cgcgagctgatccgcaaggaaatcgccgccggccgcatcggtggcaccttcaactccatc
acccgcccggaaaaccgtccgatgcaggacgcggccatgcgcagccggctgaagatcccg
atgttcttcgcctacgacgtgatccacggccaccgcacgatcttcccgatcagcctggcc
ctggcgtccagctgggacatggaggccatcggccgctccgggcgcatcgccgcccaggaa
gctgctgccgacagcctcgacatcacctttgcgccgatggtcgacatctcccgcgacccg
cgctggggccgcacctccgaaggtttcggtgaagacacctacctggtttcacgcatcgcc
gacgtcatggtcaaggcgttccagggcgtgagccccgcgaatgccgacagcatcatggcc
agcgtcaagcacttcgccctgtatggcgcggtggaaggcggtcgcgactacaacgtggtc
gacatgagcccggtcaagatgtaccaggactacctgccgccgtaccacgcggcgatcaag
gccggttcgggcggcgtgatggtggcgttgaactcgatcaacggcgtgcccgccaccgcc
aacacctggctgatgaatgacctgctgcgtcgggactggggtttcaagggcgtggccgtg
agcgaccatggcgcgatcttcgagctgatcaagcacggcgtggccaaggacgggcgcgaa
gccgccaagctggcgatcaaggccggcatcgacatgagcatgaacgactcgttgtatgcc
aaggaattgccggggctgctcaagtccggcgagatcgaacagagcgacatcgataacgcc
gtgcgcgaagtgctcggcgccaaatacgacatgggcctgttcaaggacccgtacctgcgc
atcggcaaggccgaggatgacccggccgacacctatgccgaaagccgcctgcaccgtgcc
gacgcacgcgacatcgcacgccgcagcctggtgttgctgaaaaaccagaacaacaccctg
ccgctgaaaaaatccgcgaccatcgccctggtcggcccgctggccaaggcaccgatcgac
atgatgggcagctgggccgccgccggtaagccggaacagtcggtcaccctgctggacggc
atgaacgcggtgatcggcgaaaaaggcaagatcatctatgcccgtggcgccaacatcacc
aacgacaaggccgtggtcgactacctgaacttcctcaacttcgatgcgccagaagtggtg
gatgacacccgccctgcccaagtgatgatcgacgaggccgtgaaggccgccaaggatgcc
gatgtggtggtggctgccgtgggtgaatcccgtggcatgtcccacgaatcctcgagccgc
accgacctgaacatcccgcaaagccagcgcgacctgatcaaggccttgaaagccaccggc
aagccgctggtactggtgctgatgaacggccgcccgctgtcgattgttgaagagaaccaa
caagccgacgcgatcctggaaacctggtttgccggcaccgaaggcggcaacgccatcgcc
gacgtgctgtttggtgactacaacccgtcgggcaagctgccgatcacattcccacgctcg
gtggggcagattccgacctactacaaccacctgaccgtcggccggccgttcaccccgggc
aaaccgggcaactacacctcacagtacttcgatgacaccaccgggcccctgttcccgttt
ggctatggcctgagctacaccacgttcaacctgtcggacatggcgctgtcgtccaccacg
ctgaacaagaccggcaagctcgacgccagtgtcacggtgaccaacaccggcaaggtggac
ggcgaaaccgtggtgcagttgtatatccaggacgtggctggctcgatgatccgcccgatc
aaagagctgaagaacttccagaaggtcatgctcaaggcgggtgaggagcgcacgttgcac
ttcaccatcaccgaggaagacctgaagttctacaacacccagctcaagttcgcggcggaa
ccgggtgagttcaatgtgcagatcgggttggactcccaggatgtgcagcagcagaccttc
gaactgctctga

DBGET integrated database retrieval system