KEGG   Pseudomonas trivialis: AA957_16795Help
Entry
AA957_16795       CDS       T04006                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00625  Chloroalkane and chloroalkene degradation
ptv00680  Methane metabolism
ptv01100  Metabolic pathways
ptv01120  Microbial metabolism in diverse environments
ptv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AA957_16795
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AA957_16795
Enzymes [BR:ptv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AA957_16795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AKS07713
UniProt: A0A0H5ACD7
Position
3742892..3744091
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGNGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNPIRLAHAKAQGFEIADLSTD
TPLHEQIAALLGEPEVDCAVDAVGFEARGHGHEGVKAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRALMQAIMWDRINIA
EIVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHKLFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgtggtgtcgtgtatctcggcaacggcaaggtcgaagtacagaaaatc
gactatcccaaaatgcaggacccccgtggcaggaagattgagcacggcgtcatcctgcgc
gtggtctccaccaacatctgcggctccgaccaacacatggtgcgcggccgcaccaccgcc
cagaccggcctggtgcttggtcatgaaattaccggtgaagtgatcgagaagggcagcgac
gtcgagaacctgaagatcggcgacctggtttccgttcccttcaacgtcgcgtgcggccgc
tgccgctcatgcaaagagcaacacaccggcgtgtgcctgaccgtcaacccggcccgtgcc
ggtggcgcctacggctacgtcgacatgggcgactggaccggcggccaggctgaatacgtg
ctggtgccgtacgccgacttcaacctgctgaaactgccggaccgcgacaaggccatggag
aaaatccgcgacctgacgtgcctctccgacatcctcccgaccggctaccacggcgccgtc
actgccggtgttggccctggcagcaccgtctacatcgccggcgctggcccggtcggcctg
gccgctgccgcttctgcacgcctgttgggcgctgcggtggtgatcatcggcgacgtcaac
ccaatccgcctggcccacgccaaggcacaagggttcgagattgccgacctgtccacggac
accccgctgcacgaacagatcgctgcgctgctgggtgagccggaagtggattgcgccgtc
gacgccgtaggcttcgaagcacgcggccacggccatgaaggcgtcaaggcggaagccccg
gccaccgtactcaactcgctgatgggcgtagtgcgcgtggcgggcaagatcggtatcccg
ggcctctacgtgactgaagacccgggcgccgtggatgccgctgcaaaaatgggcagcctg
agcattcgcttcggcttgggctgggccaaatcccacagcttccacaccggccagaccccg
gtgatgaagtacaaccgcgctcttatgcaggcgatcatgtgggaccgcatcaacattgcc
gagattgtgggcgtgcaggtgatcagcctggatgatgcaccacgcgggtatggcgagttc
gatgcgggtgtgccgaagaagtttgtgattgatccgcataagttgttcagcgcggcataa

DBGET integrated database retrieval system