KEGG   Pseudomonas trivialis: AA957_19175Help
Entry
AA957_19175       CDS       T04006                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00480  Glutathione metabolism
ptv00590  Arachidonic acid metabolism
ptv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AA957_19175
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AA957_19175
Enzymes [BR:ptv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AA957_19175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: AKS08155
UniProt: A0A0H5AEU6
Position
4251482..4251964
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLKALDGQELPLAPFKGQVVLVVNVASKCGLTPQYAALEKLYQQYKDQGFTVL
GLPCNQFAGQEPGTEEEIQAFCSLNYGVTFPLGSKLEVNGPDRHQLYRLLAGEGAEFPGD
ITWNFEKFLLGKDGRVLARFSPRTAPDDPTIVQAIEKALS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttccacgacctgaaactcaaagctttggacggacaagagctgccgctggcg
cccttcaaggggcaggtggtgctggtggtcaacgtggcctccaaatgtggtttgaccccg
caatacgccgcgctggaaaagctctaccagcagtacaaggaccagggctttactgtgctt
ggcttgccgtgcaatcagtttgccggccaggagccgggcactgaggaagagatccaggcg
ttctgcagcctgaattacggggtaacgttcccgctgggcagcaaactcgaggtcaacggc
cctgaccgccatcagttgtaccgcttgctggcgggcgagggcgccgagtttcccggggat
atcacctggaatttcgaaaaattcctgcttggcaaagacgggcgagtgctcgcgcgcttt
tcgccgcgcaccgcgccagacgatccaacgattgtccaagccatcgaaaaagccctgagc
tga

DBGET integrated database retrieval system