KEGG   Pseudomonas trivialis: AA957_27480Help
Entry
AA957_27480       CDS       T04006                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00071  Fatty acid degradation
ptv00072  Synthesis and degradation of ketone bodies
ptv00280  Valine, leucine and isoleucine degradation
ptv00310  Lysine degradation
ptv00362  Benzoate degradation
ptv00380  Tryptophan metabolism
ptv00620  Pyruvate metabolism
ptv00630  Glyoxylate and dicarboxylate metabolism
ptv00640  Propanoate metabolism
ptv00650  Butanoate metabolism
ptv00900  Terpenoid backbone biosynthesis
ptv01100  Metabolic pathways
ptv01110  Biosynthesis of secondary metabolites
ptv01120  Microbial metabolism in diverse environments
ptv01130  Biosynthesis of antibiotics
ptv01200  Carbon metabolism
ptv01212  Fatty acid metabolism
ptv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA957_27480
   00630 Glyoxylate and dicarboxylate metabolism
    AA957_27480
   00640 Propanoate metabolism
    AA957_27480
   00650 Butanoate metabolism
    AA957_27480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AA957_27480
   00072 Synthesis and degradation of ketone bodies
    AA957_27480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AA957_27480
   00310 Lysine degradation
    AA957_27480
   00380 Tryptophan metabolism
    AA957_27480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AA957_27480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AA957_27480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AA957_27480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptv04147]
    AA957_27480
Enzymes [BR:ptv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AA957_27480
Exosome [BR:ptv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AA957_27480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKS09700
UniProt: A0A0H5AJ42
Position
6023784..6025082
Genome map
AA seq 432 aa AA seqDB search
MTDYSFNPAPVRRVAIIGGNRLPFARSNTVYAHDSNQDLLVAALQGLVDRYNLHGQRLGE
FAAGAVIKHSRDFNLARESLLSTTLSPDTPAYDVQQACGTGLEAALLVANKIALGQIEVG
IAGGSDTTSDAPIGINESLRHTLLAANRAKGMGDKLKALLKVRPSMFFKPLLPRNGEPRT
GLSMGEHCEEMARRWQIKRLAQDELTLTSHQRLDAAYKRGFFDDLITPHRGLARDNNLRA
DASLEKLAGLSPAYDRQNGTLTAGNSTPLTDGASVVLLASEEWAAEHGWPVLAYLRTGET
AAVNFVDGTEGLLMAPAYAVPRMLKREGLSFNDFDFFEIHEAFAAQVLCTLKAWEDADYC
RERLGLDAPLGPIDRAKMNVNGGSLGCGHPFAATGGRQLAALAKIIHENGGGRGLISICA
AGGLGITAIVEK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgactgattacagcttcaacccagccccggttcgccgcgtcgcgattatcggcggcaac
cgcctcccgtttgcgcgctccaacacggtgtacgcccacgacagcaaccaggacctgctg
gtcgccgccttgcagggcctggtcgaccgctacaacctgcacggccaacgcctgggtgag
tttgccgccggggcggtgatcaagcattcgcgggatttcaacctggcgcgtgagtcgctg
ctgtccaccaccttgtccccggacaccccggcctatgatgtgcagcaagcctgcggcact
ggcctggaagcggcattgctggtggcgaacaagatcgcactggggcagatcgaggtgggc
attgccggtggttccgacaccacctccgacgcccccatcggcatcaacgaatccctgcgc
cacaccttgctcgcggccaaccgcgccaagggcatgggcgacaagctgaaggcgctgctc
aaggttcgaccgtcgatgtttttcaagccgttgctgccgcgcaatggtgagccacgcacc
ggcctgtccatgggcgaacactgcgaggaaatggccaggcgctggcagatcaagcgcctg
gcccaggatgagctgacactcaccagccatcagcgcctggatgccgcttacaaacgtggc
ttctttgacgacctgatcaccccccatcgcggcctggcccgggacaataacctgcgcgct
gacgccagcctggagaaactcgccgggctgtcacccgcctacgaccgtcagaacggcacg
cttaccgcaggcaactccacgccattgaccgatggcgcttcggtggtgctgctggccagc
gaagaatgggcggccgagcacggctggccagtgctggcttatctgcggaccggtgaaacg
gcagccgtgaacttcgtcgacggcaccgagggcctgctgatggccccggcctacgcggtg
ccacgcatgctcaagcgcgaaggcctgagcttcaatgacttcgattttttcgagatccac
gaggcctttgccgcccaggtgctgtgcacactcaaggcctgggaagacgccgattattgc
cgcgagcgtctaggcttggacgcgccgctgggccctatcgaccgggcgaaaatgaacgtc
aacggtggctcactgggttgcggccatccgttcgccgccaccggtggccggcaattggcg
gcgctggccaagatcattcatgaaaacggcggcgggcgcggcctgatttccatctgcgcg
gcgggcgggctgggcattacggccatcgtcgaaaagtag

DBGET integrated database retrieval system