KEGG   Pandoraea thiooxydans: ABW99_03770Help
Entry
ABW99_03770       CDS       T03947                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00071  Fatty acid degradation
ptx00072  Synthesis and degradation of ketone bodies
ptx00280  Valine, leucine and isoleucine degradation
ptx00310  Lysine degradation
ptx00362  Benzoate degradation
ptx00380  Tryptophan metabolism
ptx00620  Pyruvate metabolism
ptx00630  Glyoxylate and dicarboxylate metabolism
ptx00640  Propanoate metabolism
ptx00650  Butanoate metabolism
ptx00900  Terpenoid backbone biosynthesis
ptx01100  Metabolic pathways
ptx01110  Biosynthesis of secondary metabolites
ptx01120  Microbial metabolism in diverse environments
ptx01130  Biosynthesis of antibiotics
ptx01200  Carbon metabolism
ptx01212  Fatty acid metabolism
ptx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABW99_03770
   00630 Glyoxylate and dicarboxylate metabolism
    ABW99_03770
   00640 Propanoate metabolism
    ABW99_03770
   00650 Butanoate metabolism
    ABW99_03770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABW99_03770
   00072 Synthesis and degradation of ketone bodies
    ABW99_03770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABW99_03770
   00310 Lysine degradation
    ABW99_03770
   00380 Tryptophan metabolism
    ABW99_03770
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABW99_03770
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABW99_03770
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABW99_03770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptx04147]
    ABW99_03770
Enzymes [BR:ptx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABW99_03770
Exosome [BR:ptx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABW99_03770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKJ67477
UniProt: A0A0G3EQA5
Position
1625637..1626818
Genome map
AA seq 393 aa AA seqDB search
MTDIVIVSAARSGVGKFGGSLAKVPAPEIGAQVVRAVLERAGLAPEQISEVILGQVLTAG
SGQNVARQASIKAGLPSAVPAMTINKVCGSGLKAVMLAANAIQAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLIDTMIVDGLWDVYNQYHMGITAENVAKEYGITREAQDRLAV
ESQNRAEAAQKAGRFADEIVPIAIPQRKGDPVLFEHDEYIRHGATLESLAGLKPAFAKDG
SVTAGNASGLNDGAAAVVVMSAKRAAELGLTPLARIAAYANAGVDPKVMGMGPVPASRRC
LERAGWRVDDLDLLEINEAFAAQALAVHQQMGWDTSKVNVNGGAIALGHPIGASGCRILV
TLLHEMARRGAKKGLASLCIGGGMGVALAVERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagatatcgttatcgtttcagcggcccgatccggggtcggaaaattcggtggctcg
ctggccaaggtccccgcgccggagatcggtgctcaggtcgtgcgcgcggtgttggagcgc
gccgggctcgcgcccgagcagatcagcgaagtcattctcggtcaggtgctgacggcaggt
tcgggtcagaacgtggcgcgtcaggcgtcgatcaaggcagggctgcccagtgcggtgccg
gccatgaccatcaacaaggtgtgcggctcgggactcaaggcggtcatgctggcagccaac
gccattcaggccggcgacgccgaaatcgtggtggccggcggccaggaaaacatgagcgcg
gcgccgcacgtgctgccgggttcgcgtgacggctttcggatgggcgacgccaagctgatc
gataccatgatcgtcgacggtctgtgggacgtgtacaaccagtatcacatgggcattact
gcggaaaacgtcgccaaggaatacggcatcacgcgcgaggcccaggatcgcctggcggtg
gaatcgcagaatcgcgccgaggccgcgcagaaagcgggccgcttcgcggacgaaatcgtg
ccgatcgcgatcccgcagcgcaagggggatccggtgctgttcgagcacgacgaatatatt
cgccacggcgccacgctggaatcgctcgccggcctgaagccggccttcgccaaggatggc
tcggtcaccgccggtaacgcgtccgggctcaacgacggcgccgccgccgtggtcgtcatg
tcggccaaacgcgcggccgaactgggcctgacgccgctggcgcgcattgccgcctatgcc
aacgccggggtcgaccccaaggtcatgggcatgggaccggtgccggcctcgcgccgctgc
ctggagcgtgccggctggcgtgtcgacgatctcgacctgctcgagatcaatgaagcgttt
gccgcgcaggcgctggcggtgcatcagcaaatgggttgggacaccagcaaggtcaatgtc
aacggtggcgcgatcgccctggggcatccgatcggcgcatcgggctgccgcatcctggtg
acgctgctgcatgaaatggcgcggcgcggtgccaagaaggggcttgcctcgctgtgtatc
ggcggcggcatgggagttgcactggcggtcgagcgcgcctga

DBGET integrated database retrieval system