KEGG   Pandoraea thiooxydans: ABW99_05055Help
Entry
ABW99_05055       CDS       T03947                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00970  Aminoacyl-tRNA biosynthesis
ptx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABW99_05055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptx03029]
    ABW99_05055
Enzymes [BR:ptx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ABW99_05055
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ABW99_05055
Mitochondrial biogenesis [BR:ptx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ABW99_05055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKJ67686
UniProt: A0A0G3ESK0
Position
1908669..1910015
Genome map
AA seq 448 aa AA seqDB search
MSTAAPTIAELGAELAAGRLTSVALTEQALARIDTHIDGGGVAFIQVDAAGALAAARAAD
QARAAGLVASPLAGLPVSIKDLFDIRGQVTRAGSKALDGNAPAQADATAVARLRAAGAVL
IGRTNMSEFAFSGLGLNPHYGTPRNPFDSARVTGGSSSGGALSVAAGMAVAALGTDTGGS
IRIPSAFCGLTGFKPTAQRIPMDGGVPLSTTLDSAGPLARSVACCAAFDAVLSGEVLDTR
PATLAGLRLYVTRDFVGEGLDPAVAEAFDAALARLSQHGARIVTFDFPELLRLPAINAGG
GFSAAESWTWHRTLLTERGACYDPRVAMRIKRGAQQSATDYIELLAARRAMQEAAAHRLR
EADAWLMPSVAVLAPRLDSLARDEDFFAVNGLVLRNSSVINFLDGCAVSLPVAQGIGLGV
CGLQGRDARVLQVAGAIEAGLASPRIST
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggccgccccgaccattgcagaactgggcgccgaactggccgccgggcgcctc
accagcgtcgccctgaccgagcaggcgcttgcgcgcatcgacacccatatcgacggcggt
ggcgttgcgttcattcaggtggacgcggccggcgcgctggccgctgcgcgcgcggccgat
caggcgcgcgcggcgggcctggtggcatcgcctctggccggcttgccggtttcgatcaag
gacctttttgacatacgcgggcaagtcacgcgcgcaggctccaaggcgctcgacggcaat
gcgccggctcaggccgacgcgacggcggtggcgcgtctgcgcgcggcgggcgcggtattg
atcgggcgcaccaatatgagcgaattcgcgttctccggcctggggctcaaccctcactac
ggaacgccgcgcaatccgttcgactccgcccgcgtcaccgggggctcgagctcgggcggg
gcgttgagcgtggccgccggcatggcggtcgcggcgctgggcaccgatactgggggctcg
atccgaattccgtcggcgttttgcggcctgaccggcttcaagccgaccgcgcaacgcata
ccgatggacggaggcgtgccgttgtcgaccacgctggactcggcaggcccgctggcgcgc
tcggtggcgtgttgtgcggcattcgatgccgtgctcagcggcgaagtgctcgatactcga
cccgcgacgctggctgggctgcgcctgtacgtgacgcgcgacttcgtgggcgaggggctc
gatccggcggtggccgaggcgttcgacgcggcgcttgcccgtctgtcgcagcacggcgca
cggatcgtgacgttcgatttcccggaattgctgcgtttgccggcgatcaacgcaggcggc
ggtttcagcgcggccgagtcatggacttggcatcgcacgctgctgaccgaacggggcgct
tgctacgacccacgtgtggcgatgcgcattaagcgcggcgcccagcagagcgcgaccgat
tacatcgaactgttggcggcgcgccgcgccatgcaggaggctgccgcgcaccggctgcgc
gaagccgacgcgtggctcatgccaagcgtggcggtgcttgcgccgcgcctcgacagcctg
gcacgcgatgaagatttcttcgccgtcaacgggctggtgctgcgcaactcgagcgtgatc
aattttctcgatggctgcgctgtgtcgctgccggtggcacagggcatcggcctgggcgta
tgcggcctgcaggggcgagacgcgcgcgtgctgcaagtggccggcgcgatcgaggccggt
ctcgcgtcgccacggatttccacctag

DBGET integrated database retrieval system