KEGG   Pandoraea thiooxydans: ABW99_05345Help
Entry
ABW99_05345       CDS       T03947                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00010  Glycolysis / Gluconeogenesis
ptx00071  Fatty acid degradation
ptx00350  Tyrosine metabolism
ptx00625  Chloroalkane and chloroalkene degradation
ptx00626  Naphthalene degradation
ptx00680  Methane metabolism
ptx01100  Metabolic pathways
ptx01110  Biosynthesis of secondary metabolites
ptx01120  Microbial metabolism in diverse environments
ptx01130  Biosynthesis of antibiotics
ptx01200  Carbon metabolism
ptx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABW99_05345
  09102 Energy metabolism
   00680 Methane metabolism
    ABW99_05345
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABW99_05345
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ABW99_05345
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABW99_05345
   00626 Naphthalene degradation
    ABW99_05345
Enzymes [BR:ptx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABW99_05345
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     ABW99_05345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C TrkA_N UDPG_MGDP_dh_N RTC4 Methyltransf_25 Met_10
Motif
Other DBs
NCBI-ProteinID: AKJ67735
UniProt: A0A0G3EL92
Position
1963842..1964948
Genome map
AA seq 368 aa AA seqDB search
MKTRAAIAWEAGKPLTIEEVDLEGPRAGEVLIEVKATGICHTDYYTLSGADPEGLFPAIL
GHEGAGVVVDLGAGVTSLKKGDHVIPLYTPECRQCKFCLSRKTNLCQAIRATQGRGLMPD
ATSRFSLGGKPILHYMGTSTFSNYIVVPEIAVAKIREDAPFDKVCYIGCGVTTGVGAVVY
SAKVEAGANVVVFGLGGIGLNVIQGAKMVGADKIIGVDINPRRVELARKFGMTDFINPTE
VENVVDRIVQLTDGGADYSFECIGNVTTMRQALECCHKGWGQSFIIGVAAAGQEISTRPF
QLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKLNIDDLITHTLTLEQINDGFDLMKRGE
SIRSVVLY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgcgccgccatagcctgggaagcgggcaagccgttgacgatcgaggaagtc
gatctggagggcccgcgcgcgggcgaagtgctgatcgaagtgaaagccaccggcatttgc
cacaccgactactacacgctgtcgggggcggacccggaagggttgttcccggccattctg
ggccatgagggcgcgggcgtggtggtggatctgggcgcgggggtgaccagcctcaaaaag
ggcgatcacgtgatcccgctgtacacgcccgaatgccgccagtgcaaattctgcctctcg
cgcaagaccaacctgtgccaggcgatccgcgccacccaagggcgcggcctgatgcccgac
gccacctcgcgcttctcgttggggggcaagccgatcctgcactacatgggcacctccacc
ttctccaactacatcgtcgtgccggagatcgcggtggccaaaatccgcgaagacgcgccg
ttcgacaaagtgtgctacatcggctgcggggtcaccaccggggtgggcgcggtggtctac
tcggccaaggtcgaagccggggccaacgtggtggtgttcggcctgggcgggatcgggctg
aacgtgatccagggcgcgaagatggtgggcgccgacaagatcatcggcgtcgacatcaac
ccgcggcgggtcgagctcgcgcgcaaattcggcatgaccgacttcatcaaccccacggaa
gtcgagaacgtggtcgatcgcatcgtgcagctcaccgacggcggggccgactacagcttc
gagtgcatcggcaacgtcaccaccatgcgccaggcgctcgagtgctgccacaagggctgg
ggccagtcgttcatcatcggggtggcggcggccgggcaggagatcagcacgcggccgttc
cagctggtgaccgggcgcgagtggaagggctcggccttcggcggggcgcgcgggcgcacc
gacgtgccgaagatcgtcgactggtacatggaaggcaagctcaacatcgacgacctgatc
acgcacacgctcacgctcgagcagatcaacgacggcttcgacctgatgaagcgcggcgag
tcgatccgctcggtcgtactgtattga

DBGET integrated database retrieval system