KEGG   Pandoraea thiooxydans: ABW99_06155Help
Entry
ABW99_06155       CDS       T03947                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABW99_06155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ptx02022]
    ABW99_06155
Two-component system [BR:ptx02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   ABW99_06155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF43
Motif
Other DBs
NCBI-ProteinID: AKJ70409
UniProt: A0A0G3EWN8
Position
complement(2135806..2136531)
Genome map
AA seq 241 aa AA seqDB search
MENKNPPKVLVVDDDPRLRDLLRRYLGEQGLNVFVADNATSMNKLWVRERFDLLVLDLML
PGEDGLSICRRLRGANDRTPIIMLTAKGEDVDRIVGLEMGADDYLPKPFNPRELVARIHA
VLRRQAPAELPGAPSENSESFEFGDFTLNLATRTLTKKGQEIALTTGEFSVLKVFARHPR
QPLSREKLMELARGREYEVFDRSLDVQISRLRKLIEPDPSSPRYIQTVWGLGYVFIPDGG
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaaaaccctcccaaagttctggtggtcgacgacgatccgcgattgcgcgac
ctgcttcgccgttatcttggcgagcagggcttgaacgtcttcgtggccgataatgccaca
tccatgaacaagctctgggttcgcgagcgattcgatctgttggtactcgacctgatgctg
cccggagaagacggcctgtcgatctgccgccggctgcggggcgccaacgatcgaacgccg
atcatcatgttaactgccaaaggcgaagatgtcgaccgcatcgttggtctcgaaatggga
gctgacgactacctgcccaagccgttcaacccgcgtgagctggtcgcccgcatccatgcc
gtgttgcgccgccaggcgcctgccgaattgcccggcgcgccgagcgagaactccgagtcg
ttcgaattcggcgacttcacgctgaatctggccacccgcaccctgaccaagaaaggccag
gaaattgcactgaccaccggcgaattttcggtgctcaaagtttttgcccgtcatccgcgt
caaccgctgtcgcgcgagaaattaatggaactcgcgcgcggccgagagtacgaagtattc
gatcgcagcctggacgtgcagatctcgcgactgcgcaagctgatcgagcccgatcccagc
agcccccgctacatccagaccgtgtggggtctgggttatgttttcatccccgacggcgga
gtctga

DBGET integrated database retrieval system