KEGG   Pandoraea thiooxydans: ABW99_14820Help
Entry
ABW99_14820       CDS       T03947                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABW99_14820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptx01007]
    ABW99_14820
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ptx03016]
    ABW99_14820
   03029 Mitochondrial biogenesis [BR:ptx03029]
    ABW99_14820
Enzymes [BR:ptx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     ABW99_14820
Amino acid related enzymes [BR:ptx01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   ABW99_14820
Transfer RNA biogenesis [BR:ptx03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ABW99_14820
 Prokaryotic Type
   Other AARSs
    ABW99_14820
Mitochondrial biogenesis [BR:ptx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ABW99_14820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AKJ69300
UniProt: A0A0G3EQP1
Position
4031031..4032788
Genome map
AA seq 585 aa AA seqDB search
MLPAQKNTIAVLLADAVAPFVEAGANLPPIVLERPKAAAHGDLACNIALQLAKPLKANPR
DLAQRIAAAVQADPRAAGLIEQTEIAGPGFINLRLSPAAKQAVAREIVTQGNAFGCQPLD
KTKHVLLEFVSANPTGPLHVGHGRQAALGDALANLLATQGWEVYREFYYNDAGVQINTLA
ISVQARAKGLKPGDADWPEAAYNGDYIADIARDYLNRQTVQAADNAPVTGAGELDDLEAI
RKFAVAYLRHEQDIDLQTFGVRFDRYYLESSLYTEGRVEQTVQALIAAGKTYEQDGALWL
RTTDYGDDKDRVMRKSDGTYTYFVPDVAYHVSKWQRGFTKVINIQGSDHHGTIARVRAGL
QGLGIGIPADYPDYVLHKMVTVMKGGQEVKISKRAGSYVTVRDLIEWSGGLTEGSARENL
SDAAREDALRRGRDAVRFFLISRKADTEFVFDVDLALKQNDENPVYYVQYAHARICSVLT
QWGGDPATLDTTDLGPLRGDHALALLQQLAEYPDALTRAAEELAPHAVAFYLRDLAGSFH
SFYNAERVLVDDEPLKLARLALLKATRQVLRNGLAVLGVSAPEQM
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgttgccagcacagaaaaacaccatcgccgtcctcctggccgatgccgtcgcgccattc
gtcgaagccggcgcgaacttgccgcccatcgtcctcgagcggcccaaagccgctgcccat
ggcgatctcgcctgcaatatcgcgctgcaactggccaagccgctcaaggccaacccgcgc
gacctggcgcagcgcattgccgccgctgtccaggcagatccccgtgccgccggcctgatc
gagcagacggaaattgccgggcccggcttcatcaacctgcggctgagccccgcggcaaag
caagcggtcgcacgtgagatcgtcacgcagggcaacgcgtttggctgccaaccgctcgat
aaaaccaaacacgtcctattggaatttgtttccgccaacccgaccggcccactgcacgtc
ggtcatggccgccaggctgctctgggcgatgcgctggccaacctgctcgccactcaaggg
tgggaagtctaccgcgagttttactataacgacgccggcgtgcagatcaatacgctggcc
atctcggtccaggcgcgcgccaaagggctcaagccgggcgacgcggactggccggaggcc
gcctacaacggcgactatattgccgacatcgcgcgcgactacctgaatcgccagaccgtt
caggcggcagacaacgctcccgtgaccggcgccggggagctcgacgatctcgaggcgatc
cgcaaattcgccgtggcctatctgcgtcacgagcaggacatcgacctgcaaaccttcggg
gttcgtttcgatcgctactacctcgaatcgtcactttataccgagggccgcgtcgagcaa
acggtgcaggcattgattgccgcgggcaagacctacgagcaggacggtgcgctgtggctc
agaaccaccgactatggcgacgacaaggatcgcgtcatgcgtaaatccgacggcacgtac
acctacttcgtgcccgacgtggcctaccacgtcagcaaatggcagcgcggctttaccaag
gtcatcaatatccagggctccgaccatcacggcaccatcgcccgtgtgagggccggcctg
caaggcctgggcatcggcattccggccgactatcccgattacgtcctgcacaagatggtc
acggtgatgaagggcggacaggaggtcaagatctccaagcgcgccggcagctacgtgacg
gtgcgcgacctgatcgaatggtcgggcggcctcaccgaaggcagtgcgcgcgagaacctg
agcgacgcggcgcgcgaggacgccctgcggcgcggacgcgatgccgtgcgctttttcctg
atctcccgcaaggccgataccgagttcgtcttcgacgtcgatctggcgctcaagcaaaac
gacgagaatccggtgtactacgtgcaatacgcgcatgcgcgcatctgctcggtgctgacg
cagtgggggggcgaccccgccacgctcgatacgaccgatctcggcccgctgcgcggcgac
cacgcattggcgctgctccagcagcttgccgaatacccggacgcgctcacccgtgcggcc
gaggagctcgcgccgcatgcggttgcgttctacctgcgcgacctggccggctcgttccac
tcgttctacaatgccgagcgcgtgctggtcgacgacgaacccctgaagctggcccgactg
gccttgctcaaagccacgcgccaggtgttgcgcaacggcctggcggtgctcggcgtatcg
gcacccgagcaaatgtga

DBGET integrated database retrieval system