KEGG   Candidatus Pelagibacter ubique: SAR11_0314Help
Entry
SAR11_0314        CDS       T00257                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00010  Glycolysis / Gluconeogenesis
pub00620  Pyruvate metabolism
pub00640  Propanoate metabolism
pub00680  Methane metabolism
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01130  Biosynthesis of antibiotics
pub01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_0314 (acsA)
   00620 Pyruvate metabolism
    SAR11_0314 (acsA)
   00640 Propanoate metabolism
    SAR11_0314 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SAR11_0314 (acsA)
Enzymes [BR:pub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAR11_0314 (acsA)
Lipid biosynthesis proteins [BR:pub01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAR11_0314 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Ribosomal_S20p
Motif
Other DBs
NCBI-ProteinID: AAZ21136
UniProt: Q4FNV3
Position
310070..312115
Genome map
AA seq 681 aa AA seqDB search
MPKKKSISKAKKKTSKKTKAKKKVKPFIKKVLKKIEEKELIIKTKPEWVKSALVNKAKYQ
KKYSDAIKKNDDFWKNEGKRITWIKPYKKIKNIKYSKKEVKIKWYEDGTLNASANCIDRH
LKDKKDKTAIIWVGDDPKDTKKISYKQLHNEVSKAANGLRKLGIKKGDRVTIYLTMIPEL
AVTMLACARIGAVHSIIFGGFSADSISGRVNDCESEYIITADEGVRGGKTIPLKQITDEA
LRSCPNVKKCIVVKRTGNKVSWVKGRDVWFDDLIKDMSTKCEPEEMNAEDPLFILYTSGS
TGKPKGVLHTTGGYMVYASMTHQYIFNYKPKDVYWCTADIGWVTGHSYIVYGPLANGATT
IMFEGIPTYPDSSRWWQIIDKYKVNIFYTAPTAIRALMREGDKPVKKTSRKSLKLLGTVG
EPINPEAWMWYYKTVGNSKCPIVDTWWQTETGGILISPQTGAMNLKPGSASKPFYGIKPS
IVDKDGKEIKGAGEGRLCISQSWPGQMRTVYGDHQRFIDTYFSQFDGKYFTGDGAKRDKD
GYYWITGRVDDVIIVSGHNLGTAEIESAFVAHPKVAEAAVVGYPHDIKGNGLYCYVTLNV
GEKSDLDLERDLKLWVRKQIGALATPDIIHFSPGLPKTRSGKIMRRILRKIAANEHDQLG
DTTTLADPSVVQSLVDNRKNI
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaaaaagtcaatatcgaaagcgaaaaaaaaaacttctaaaaaaactaaggct
aaaaaaaaagtaaagccttttataaaaaaggttttaaaaaaaatcgaagaaaaagaatta
atcataaaaactaaacctgagtgggtaaaaagtgctctagtaaataaagcgaaatatcaa
aaaaaatactcagacgcgattaaaaaaaatgatgacttttggaagaatgaggggaaaaga
attacttggattaaaccgtacaaaaagattaaaaatataaaatacagtaaaaaagaggtt
aaaattaaatggtatgaggatggcacattaaatgcttctgccaattgtatagaccgtcac
cttaaagataaaaaagataaaactgctattatttgggtaggtgatgatccaaaagatact
aaaaaaatttcgtacaaacaattacataatgaagtttctaaagctgcaaatggtttaaga
aaactaggaattaaaaaaggtgatcgagttacaatttatttaactatgattccagaactg
gcagtaacaatgcttgcttgtgctagaattggtgcagttcactctattatttttggtggt
ttttcagcagactctatttctggcagggttaatgactgtgagtcagaatatataataact
gctgatgaaggtgttaggggggggaaaactattccattaaaacaaattacagatgaggct
ttaagaagttgtcctaatgtcaaaaaatgtattgttgtaaaaagaactggaaataaagtt
agttgggttaaaggaagagatgtttggtttgacgatttaattaaagatatgtcaactaaa
tgtgagcctgaggaaatgaatgcagaagatcctttgtttattctttacacatctggctct
actggaaaaccaaaaggagttttacatacaacaggtggatatatggtttatgcatccatg
acccatcaatatatttttaattataaaccaaaagatgtttattggtgtactgctgatatt
ggttgggtaacgggtcacagttatattgtttatggaccacttgctaatggtgccacaaca
ataatgtttgaaggaattccaacctatccagacagctcaaggtggtggcaaattattgat
aaatacaaagttaatattttttatacagcgcccactgctattagagctttaatgagagag
ggtgataagcctgttaagaaaacctcaagaaaatctttaaaattattaggaactgttggt
gaacccattaatcctgaagcttggatgtggtattataaaacagttggaaattctaaatgt
ccaattgttgatacatggtggcaaactgaaacaggtggaattttaattagccctcaaaca
ggagctatgaatttaaaacctggttctgcaagtaaacccttttatggaattaagccctct
atagttgataaagatggtaaagaaatcaaaggagctggtgaaggaagattgtgcatttct
caatcttggcctggacaaatgagaactgtttatggtgatcatcaaagatttattgatact
tatttttctcagttcgatggaaaatatttcacaggtgatggtgctaaaagagacaaggat
ggctattactggataactggccgtgtagatgatgtaattattgtctctggtcataacctt
ggaactgccgagatagaaagtgcttttgttgctcatccaaaagttgctgaagctgctgtg
gttggatatccacatgatattaaaggtaacggcctatattgttatgtaactctaaatgtt
ggagagaaatcagatttagatcttgaaagagatttaaagctttgggtaagaaaacaaatc
ggtgcactagcgacacctgacattattcatttctcacctggacttccaaaaacaaggtct
ggaaaaattatgagaagaattttaagaaaaattgcagctaatgaacatgaccaattaggg
gatacaacaactttagctgatccaagcgttgtgcaaagtttggtggataatagaaagaat
atttaa

DBGET integrated database retrieval system