KEGG   Candidatus Pelagibacter ubique: SAR11_0428Help
Entry
SAR11_0428        CDS       T00257                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00071  Fatty acid degradation
pub00280  Valine, leucine and isoleucine degradation
pub00310  Lysine degradation
pub00362  Benzoate degradation
pub00380  Tryptophan metabolism
pub00620  Pyruvate metabolism
pub00630  Glyoxylate and dicarboxylate metabolism
pub00640  Propanoate metabolism
pub00650  Butanoate metabolism
pub00900  Terpenoid backbone biosynthesis
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01130  Biosynthesis of antibiotics
pub01200  Carbon metabolism
pub01212  Fatty acid metabolism
pub02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAR11_0428 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    SAR11_0428 (thlA)
   00640 Propanoate metabolism
    SAR11_0428 (thlA)
   00650 Butanoate metabolism
    SAR11_0428 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAR11_0428 (thlA)
   00072 Synthesis and degradation of ketone bodies
    SAR11_0428 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAR11_0428 (thlA)
   00310 Lysine degradation
    SAR11_0428 (thlA)
   00380 Tryptophan metabolism
    SAR11_0428 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAR11_0428 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAR11_0428 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAR11_0428 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pub04147]
    SAR11_0428 (thlA)
Enzymes [BR:pub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAR11_0428 (thlA)
Exosome [BR:pub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAR11_0428 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAZ21250
UniProt: Q4FNI9
Position
415586..416773
Genome map
AA seq 395 aa AA seqDB search
MTKKLDDVVITAALRTPIGTYKGSLKDLSADKLGALAIKEAVYKSKLKSDDIDEVIMGHV
LTSGLGQNPARQASIHAGIPVSKPAHIINQVCGSGLRSVISGYQSIKLGENKIIVAGGQE
NMSRAPHAIFYREDKRLDENKLVDTMINDGLIDSFNNYHMGITAENVAEKYKISRDEQDL
FALNSQEKTQQAINENRFKNELIKLKIDTDNKNFLFEKDEHPRSNLNLEDLKKLKTVFKE
NGTVTAGNSSGINDGAAATILMSRDEAEHRDIEPLAKVVSWATCGVEPSLMGLGPIQAVN
IALEKAEWRREDVDLFEINEAFAAQSIAVIRDLKIPKEIVNVNGGAIALGHPIGASGTRI
LVTLIHEMIRRNKSKGCATLCIGGGMGIAMCIERN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaactagatgatgtagttattacagctgcattaagaacacctataggcaca
tataaaggatctttaaaagatttgagtgctgataaattaggtgcattagctattaaagaa
gctgtctataaatcaaaattaaaatcagacgatattgatgaagtgattatgggacatgtt
ttaacttctgggctaggacaaaacccagcaagacaagcttctattcatgctggaattcca
gtttcaaaacctgcacatataatcaatcaagtatgtggatctggattaagatctgtaatt
tcaggatatcagtctattaaactaggtgaaaataaaattatagttgctggtggacaagaa
aatatgtctagagcaccacatgctatattttatcgagaagataaaagactagatgaaaat
aagttagtagatacgatgatcaatgatggattaatagactcgtttaacaattatcacatg
ggaataactgctgaaaatgttgcagaaaaatataaaatttctagagatgaacaagattta
tttgcattaaattctcaagaaaaaactcaacaagctataaatgaaaatagattcaaaaat
gagctgatcaaattaaagattgatacagataataaaaattttctttttgaaaaagatgaa
catccaagaagcaatttaaatttagaagatctaaaaaaactaaaaactgttttcaaagaa
aatggaacagtcaccgcaggaaattcatcaggaatcaatgatggtgcggcagcaactata
ttaatgtctagagatgaagcagaacatagagacatagagcctttagctaaagtagtctct
tgggcaacttgtggtgttgaaccctcgttgatggggttaggtccaattcaagctgttaat
atagctttagaaaaagctgaatggaggagagaagatgtcgatttatttgaaataaatgaa
gcatttgcagctcaaagtattgctgtaattagagatcttaaaattcctaaagagattgta
aatgttaatggtggggcaattgcattaggacatccaattggagcttcaggaaccagaatt
ttagtaactcttattcatgagatgattagacgaaataaaagcaaaggttgtgccaccctc
tgtattggtggtggaatgggaatagccatgtgcattgagagaaattaa

DBGET integrated database retrieval system